Dataset for protein Bcl-w of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3ND50_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
I3ND50_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                      **************************************************

I3ND50_BCL2L2-02      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
I3ND50_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                      **************************************************

I3ND50_BCL2L2-02      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----L
I3ND50_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
                      ********************************************     *

I3ND50_BCL2L2-02      FSRGNMGALI----GGWDSC----AGKEAWG------------
I3ND50_BCL2L2-01      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
                      :. * :        *.* *     :*  * *            

© 1998-2019