Dataset for protein Bcl-xL of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287CZ07_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSA
I3MUP5_BCL2L1-03        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSA
I3MUP5_BCL2L1-01        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSA
I3MUP5_BCL2L1-02        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSA
                        **************************************************

A0A287CZ07_BCL2L1-      INGNPSWHLADSPAINGATGHSSSLDAREVIPMAAVKQALREAGDEFELW
I3MUP5_BCL2L1-03        INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
I3MUP5_BCL2L1-01        INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
I3MUP5_BCL2L1-02        INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                        **************:**********************************.

A0A287CZ07_BCL2L1-      YWRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGHIVAFLSFGGAL
I3MUP5_BCL2L1-03        YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
I3MUP5_BCL2L1-01        YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
I3MUP5_BCL2L1-02        YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                        *.************* **********************.****:******

A0A287CZ07_BCL2L1-      CMESVDKEMQVLVSRIASWM---------PWIQENGGWDTFVELYRNNAA
I3MUP5_BCL2L1-03        CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
I3MUP5_BCL2L1-01        CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
I3MUP5_BCL2L1-02        CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                        *:******************         **************** ****

A0A287CZ07_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
I3MUP5_BCL2L1-03        AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
I3MUP5_BCL2L1-01        AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
I3MUP5_BCL2L1-02        AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                        *********************************

© 1998-2019