Dataset for protein Mcl-1 of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B4DLY8_MCL1-01      MFGLKRNAVIGLNLYCGGAG----------------------------------------
B4DG83_MCL1-01      -------------------M----------------------------------------
B4E3L8_MCL1-01      -------------------M----------------------------------------
Q07820_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
Q07820_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
B4DU51_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEM--------------------
C8YZ26_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL------------------------
Q07820_MCL1-04      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL------------------------
                                                                                

B4DLY8_MCL1-01      ---------------------------------------------------LGAGSGGAT
B4DG83_MCL1-01      ---------------------------------------------------EAPAADAIM
B4E3L8_MCL1-01      ---------------------------------------------------EAPAADAIM
Q07820_MCL1-03      AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
Q07820_MCL1-01      AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
B4DU51_MCL1-01      ---------------------------------------------------EAPAADAIM
C8YZ26_MCL1-01      ------------------------------------------------------------
Q07820_MCL1-04      ------------------------------------------------------------
                                                                                

B4DLY8_MCL1-01      RPGGRLLATEKEASARRE--------IGGGEAGAVIGGSAGASPPSTLTPDSR-------
B4DG83_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
B4E3L8_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
Q07820_MCL1-03      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
Q07820_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
B4DU51_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPLTPPPAEEEEDELYRQSLE
C8YZ26_MCL1-01      ------------------------------------------------------------
Q07820_MCL1-04      ------------------------------------------------------------
                                                                                

B4DLY8_MCL1-01      ------RVARPPPKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
B4DG83_MCL1-01      IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
B4E3L8_MCL1-01      IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
Q07820_MCL1-03      IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV-----
Q07820_MCL1-01      IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
B4DU51_MCL1-01      IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
C8YZ26_MCL1-01      ---------ATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRRLDIKNE
Q07820_MCL1-04      ---------ATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
                              . .************************************* :  :     

B4DLY8_MCL1-01      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
B4DG83_MCL1-01      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
B4E3L8_MCL1-01      DDVKSLSRVMIHVFSDSVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Q07820_MCL1-03      ------------LPCRGPRRW---------------------HQECAAGFCRCCWS----
Q07820_MCL1-01      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
B4DU51_MCL1-01      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
C8YZ26_MCL1-01      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Q07820_MCL1-04      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                                : . .  .*                     ::.*   :. .  .    

B4DLY8_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
B4DG83_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
B4E3L8_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Q07820_MCL1-03      --RSWF---------------------------------GISNKIALL--
Q07820_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
B4DU51_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
C8YZ26_MCL1-01      TKRDWLVKQRGWDGFVEFFQVEDLEGGIRNVLLAFAGVAGVGAGLAYLKR
Q07820_MCL1-04      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                      *.*:                                 *:.  :* *  

© 1998-2019