Dataset for protein BCL-2-like of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q16548_BCL2A1-01       --------------------------------------------------
B4E1X9_BCL2A1-01       --------------------------------------------------
Q16548_BCL2A1-02       --------------------------------------------------
Q07817_BCL2L1-02       ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTE--------
Q07817_BCL2L1-01       ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTE--------
Q07817_BCL2L1-03       ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTE--------
Q92843_BCL2L2-02       -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
B4DLY8_MCL1-01         MFGLKRNAVIGLNLYCGGAG------------------------------
B4DG83_MCL1-01         -------------------M------------------------------
B4E3L8_MCL1-01         -------------------M------------------------------
Q07820_MCL1-03         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGG
Q07820_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGG
B4DU51_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEM----------
C8YZ26_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL--------------
Q07820_MCL1-04         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL--------------
P10415_BCL2-04         MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-01         MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-02         MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
A9QXG9_BCL2-01         MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
Q9HD36_BCL2L10-01      MVDQLRERTTMADPLRERTELLLADY-----LGYCAR-------------
Q9HD36_BCL2L10-02      MVDQLRERTTMADPLRERTELLLADY-----LGYCAR-------------
                                                                         

Q16548_BCL2A1-01       --------------------------------------------------
B4E1X9_BCL2A1-01       --------------------------------------------------
Q16548_BCL2A1-02       --------------------------------------------------
Q07817_BCL2L1-02       --------------------------------------------------
Q07817_BCL2L1-01       --------------------------------------------------
Q07817_BCL2L1-03       --------------------------------------------------
Q92843_BCL2L2-02       --------------------------------------------------
B4DLY8_MCL1-01         --------------------------------------------------
B4DG83_MCL1-01         --------------------------------------------------
B4E3L8_MCL1-01         --------------------------------------------------
Q07820_MCL1-03         GEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFA
Q07820_MCL1-01         GEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFA
B4DU51_MCL1-01         --------------------------------------------------
C8YZ26_MCL1-01         --------------------------------------------------
Q07820_MCL1-04         --------------------------------------------------
P10415_BCL2-04         --------------------------------------------------
P10415_BCL2-01         --------------------------------------------------
P10415_BCL2-02         --------------------------------------------------
A9QXG9_BCL2-01         --------------------------------------------------
Q9HD36_BCL2L10-01      --------------------------------------------------
Q9HD36_BCL2L10-02      --------------------------------------------------
                                                                         

Q16548_BCL2A1-01       --------------------------------------------------
B4E1X9_BCL2A1-01       --------------------------------------------------
Q16548_BCL2A1-02       --------------------------------------------------
Q07817_BCL2L1-02       -----------APEGTESEMETPSAINGNPSWHLADSPAV----------
Q07817_BCL2L1-01       -----------APEGTESEMETPSAINGNPSWHLADSPAV----------
Q07817_BCL2L1-03       -----------APEGTESEMETPSAINGNPSWHLADSPAV----------
Q92843_BCL2L2-02       -----------EGPAADPLHQ-----------------------------
B4DLY8_MCL1-01         -----------LGAGSGGATRPGGRLLATEKEASARRE--------IGGG
B4DG83_MCL1-01         -----------EAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
B4E3L8_MCL1-01         -----------EAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
Q07820_MCL1-03         PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
Q07820_MCL1-01         PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
B4DU51_MCL1-01         -----------EAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
C8YZ26_MCL1-01         --------------------------------------------------
Q07820_MCL1-04         --------------------------------------------------
P10415_BCL2-04         -----------APPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPA
P10415_BCL2-01         -----------APPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPA
P10415_BCL2-02         -----------APPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPA
A9QXG9_BCL2-01         -----------APPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPA
Q9HD36_BCL2L10-01      -----------EPGTPEPAPS--------TPEAAVLRSAAAR--------
Q9HD36_BCL2L10-02      -----------EPGTPEPAPS--------TPEAAVLRSAAAR--------
                                                                         

Q16548_BCL2A1-01       --------------------------MTDCEFGYIYRLAQDYLQCVLQIP
B4E1X9_BCL2A1-01       --------------------------MTDCEFGYIYRLAQDYLQCVLQIP
Q16548_BCL2A1-02       --------------------------MTDCEFGYIYRLAQDYLQCVLQIP
Q07817_BCL2L1-02       --------------------------------------NGATGHSSSLDA
Q07817_BCL2L1-01       --------------------------------------NGATGHSSSLDA
Q07817_BCL2L1-03       --------------------------------------NGATGHSSSLDA
Q92843_BCL2L2-02       --------------------------------------------------
B4DLY8_MCL1-01         EAGAVIGGSAGASPPSTLTPDSR-------------RVARPPPKDTKPMG
B4DG83_MCL1-01         GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
B4E3L8_MCL1-01         GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
Q07820_MCL1-03         GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
Q07820_MCL1-01         GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
B4DU51_MCL1-01         GNNTSTDGSLPLTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
C8YZ26_MCL1-01         ---------------------------------------ATGAKDTKPMG
Q07820_MCL1-04         ---------------------------------------ATGAKDTKPMG
P10415_BCL2-04         APGAAAGPALSPVPPVVHL-------------------------------
P10415_BCL2-01         APGAAAGPALSPVPPVVHL-------------------------------
P10415_BCL2-02         APGAAAGPALSPVPPVVHL-------------------------------
A9QXG9_BCL2-01         APGAAAGPALSPVPPVVHL-------------------------------
Q9HD36_BCL2L10-01      --------------------------------------------------
Q9HD36_BCL2L10-02      --------------------------------------------------
                                                                         

Q16548_BCL2A1-01       QPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQV
B4E1X9_BCL2A1-01       QPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQV
Q16548_BCL2A1-02       QPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQV
Q07817_BCL2L1-02       REVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQ-
Q07817_BCL2L1-01       REVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQV
Q07817_BCL2L1-03       REVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQV
Q92843_BCL2L2-02       -----------AMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQV
B4DLY8_MCL1-01         RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
B4DG83_MCL1-01         RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
B4E3L8_MCL1-01         RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
Q07820_MCL1-03         RSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV---------------
Q07820_MCL1-01         RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
B4DU51_MCL1-01         RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
C8YZ26_MCL1-01         RSGATSRKALETLRRVGDGVQRNHETAFQGMLRRLDIKNEDDVKS-LSRV
Q07820_MCL1-04         RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
P10415_BCL2-04         -----------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATV
P10415_BCL2-01         -----------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATV
P10415_BCL2-02         -----------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATV
A9QXG9_BCL2-01         -----------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATV
Q9HD36_BCL2L10-01      ------------LRQIHRSFFSAY---LGYPGNRFELVALMADSV-LSD-
Q9HD36_BCL2L10-02      ------------LRQIHRSFFSAY---LGYPGNRFELVALMADSV-LSD-
                                   :.     .       :      .               

Q16548_BCL2A1-01       MEKEFEDGIINWGRIVTIFAFEGILI------------------KKLLRQ
B4E1X9_BCL2A1-01       MEKEFEDGIINWGRIVTIFAFEGILI------------------KKLLRQ
Q16548_BCL2A1-02       MEKEFEDGIINWGRIVTIFAFEGILI------------------KKLLRQ
Q07817_BCL2L1-02       --------------------------------------------------
Q07817_BCL2L1-01       VNELFRDGV-NWGRIVAFFSFGGALC------------------VESVDK
Q07817_BCL2L1-03       VNELFRDGV-NWGRIVAFFSFGGALC------------------VESVDK
Q92843_BCL2L2-02       SDELFQGGP-NWGRLVAFFVFGAALC------------------AESVNK
B4DLY8_MCL1-01         MIHVFSDGVTNWGRIVTLISFGAFVAKH----------------LKTINQ
B4DG83_MCL1-01         MIHVFSDGVTNWGRIVTLISFGAFVAKH----------------LKTINQ
B4E3L8_MCL1-01         MIHVFSDSVTNWGRIVTLISFGAFVAKH----------------LKTINQ
Q07820_MCL1-03         ---LPCRGPRRW-------------------------------------H
Q07820_MCL1-01         MIHVFSDGVTNWGRIVTLISFGAFVAKH----------------LKTINQ
B4DU51_MCL1-01         MIHVFSDGVTNWGRIVTLISFGAFVAKH----------------LKTINQ
C8YZ26_MCL1-01         MIHVFSDGVTNWGRIVTLISFGAFVAKH----------------LKTINQ
Q07820_MCL1-04         MIHVFSDGVTNWGRIVTLISFGAFVAKH----------------LKTINQ
P10415_BCL2-04         VEELFRDGV-NWGRIVAFFEFGGVMC------------------VESVNR
P10415_BCL2-01         VEELFRDGV-NWGRIVAFFEFGGVMC------------------VESVNR
P10415_BCL2-02         VEELFRDGV-NWGRIVAFFEFGGVMC------------------VESVNR
A9QXG9_BCL2-01         VEELFRDGV-NWGRIVAFFEFGGVMC------------------VESVNR
Q9HD36_BCL2L10-01      -----SPGP-TWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEG
Q9HD36_BCL2L10-02      -----SPGP-TWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEG
                                                                         

Q16548_BCL2A1-01       QIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN--------------
B4E1X9_BCL2A1-01       QIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWVC--------------
Q16548_BCL2A1-02       QIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK--------------
Q07817_BCL2L1-02       ----------------------------------DT--------------
Q07817_BCL2L1-01       EMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT--------------
Q07817_BCL2L1-03       EMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT--------------
Q92843_BCL2L2-02       EMEPLVG---QVQEWMVAYLETQLADWIHSSGGWAE--------------
B4DLY8_MCL1-01         ESC--IE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
B4DG83_MCL1-01         ESC--IE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
B4E3L8_MCL1-01         ESC--IE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
Q07820_MCL1-03         QEC--AA---GFCRCCWS------RSWF----------------------
Q07820_MCL1-01         ESC--IE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
B4DU51_MCL1-01         ESC--IE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
C8YZ26_MCL1-01         ESC--IE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
Q07820_MCL1-04         ESC--IE---PLAESITDVLVRTKRDWLVKQRGWDG--------------
P10415_BCL2-04         EMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW----------------
P10415_BCL2-01         EMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWDA--------------
P10415_BCL2-02         EMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWDA--------------
A9QXG9_BCL2-01         EMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWDA--------------
Q9HD36_BCL2L10-01      DVARDCQ---RLVALLSSRLMGQHRAWLQAQGGWDG--------------
Q9HD36_BCL2L10-02      DVARDCQ---RLVALLSSRLMGQHRAWLQAQGGWVSTRRTPGHGAGRAAG
                                                                         

Q16548_BCL2A1-01       -------------------------GFVKKFEPKSGWMTFLEVTGKIC--
B4E1X9_BCL2A1-01       -------------------------VMEKFF-------IVLSCEIEIE--
Q16548_BCL2A1-02       -------------------------WHNHTP-------MLVESVAHKK--
Q07817_BCL2L1-02       --------------------------FVELY-------GNNAAAESRKGQ
Q07817_BCL2L1-01       --------------------------FVELY-------GNNAAAESRKGQ
Q07817_BCL2L1-03       --------------------------FVELY-------GNNAAAESRKGQ
Q92843_BCL2L2-02       --------------------------FTALY-------GDGALEEARR--
B4DLY8_MCL1-01         --------------------------FVEFF-------HVEDLEGGIR--
B4DG83_MCL1-01         --------------------------FVEFF-------HVEDLEGGIR--
B4E3L8_MCL1-01         --------------------------FVEFF-------HVEDLEGGIR--
Q07820_MCL1-03         --------------------------------------------------
Q07820_MCL1-01         --------------------------FVEFF-------HVEDLEGGIR--
B4DU51_MCL1-01         --------------------------FVEFF-------HVEDLEGGIR--
C8YZ26_MCL1-01         --------------------------FVEFF-------QVEDLEGGIR--
Q07820_MCL1-04         --------------------------FVEFF-------HVEDLEGGIR--
P10415_BCL2-04         --------------------------------------------------
P10415_BCL2-01         ------------------FVELYGPSMRPLF-------DFSWLSLKTL--
P10415_BCL2-02         ------------------FVELYGPSMRPLF-------DFSWLSLKTL--
A9QXG9_BCL2-01         ------------------FVELYGPSMRPLF-------DFSWLSLKTL--
Q9HD36_BCL2L10-01      ---------FCHFFRTPFPLAFWRKQLVQAF-------LSCLLTTAFI--
Q9HD36_BCL2L10-02      KRPRGWHGWLLSLLQDPLSTGFLEKTAGPGF-------SVMLVNNSLH--
                                                                         

Q16548_BCL2A1-01       -----------------------------EMLSLLKQYC
B4E1X9_BCL2A1-01       -----------------------------NFLAS-----
Q16548_BCL2A1-02       -----------------------------RKMAL-----
Q07817_BCL2L1-02       ERFNRWFLTGMTVAGV-------------VLLGSLFSRK
Q07817_BCL2L1-01       ERFNRWFLTGMTVAGV-------------VLLGSLFSRK
Q07817_BCL2L1-03       ERFNRWFLTGMTVAGV-------------VLLGSLFSRK
Q92843_BCL2L2-02       -------LREGNWASVRTVLTGAVALGALVTVGAFFASK
B4DLY8_MCL1-01         -------NVLLAFAGVAG-----------VGAGLAYLIR
B4DG83_MCL1-01         -------NVLLAFAGVAG-----------VGAGLAYLIR
B4E3L8_MCL1-01         -------NVLLAFAGVAG-----------VGAGLAYLIR
Q07820_MCL1-03         -----------------G-----------ISNKIALL--
Q07820_MCL1-01         -------NVLLAFAGVAG-----------VGAGLAYLIR
B4DU51_MCL1-01         -------NVLLAFAGVAG-----------VGAGLAYLIR
C8YZ26_MCL1-01         -------NVLLAFAGVAG-----------VGAGLAYLKR
Q07820_MCL1-04         -------NVLLAFAGVAG-----------VGAGLAYLIR
P10415_BCL2-04         ------------VGALGD-----------VSLG------
P10415_BCL2-01         -------LSLALVGAC-------------ITLGAYLGHK
P10415_BCL2-02         -------LSLALVGAC-------------ITLGAYLGHK
A9QXG9_BCL2-01         -------LSLALVGAC-------------ITLGAYLSHK
Q9HD36_BCL2L10-01      -------YLWTRLL-------------------------
Q9HD36_BCL2L10-02      -------LSLDTIIMSFK-----------TFNPLLPAQL
                                                              

© 1998-2019