Dataset for protein Bcl2l10 of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9HD36_BCL2L10-01      MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLR
Q9HD36_BCL2L10-02      MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLR
                       **************************************************

Q9HD36_BCL2L10-01      SAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTL
Q9HD36_BCL2L10-02      SAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTL
                       **************************************************

Q9HD36_BCL2L10-01      VTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLM
Q9HD36_BCL2L10-02      VTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLM
                       **************************************************

Q9HD36_BCL2L10-01      GQHRAWLQAQGGWDG-----------------------FCHFFRTPFPLA
Q9HD36_BCL2L10-02      GQHRAWLQAQGGWVSTRRTPGHGAGRAAGKRPRGWHGWLLSLLQDPLSTG
                       ************* .                       :  ::. *:. .

Q9HD36_BCL2L10-01      FWRKQLVQAFLSCLLTTAFIYLWTRLL--------------
Q9HD36_BCL2L10-02      FLEKTAGPGFSVMLVNNSLHLSLDTIIMSFKTFNPLLPAQL
                       *  *    .*   *:..::      ::              

© 1998-2019