Dataset for protein Bcl-xL of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q07817_BCL2L1-02      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-03      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
                      **************************************************

Q07817_BCL2L1-02      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-03      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

Q07817_BCL2L1-02      YRRAFSDLTSQLHITPGTAYQSFEQ-------------------------
Q07817_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-03      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      *************************                         

Q07817_BCL2L1-02      --------------------------------------DTFVELYGNNAA
Q07817_BCL2L1-01      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
Q07817_BCL2L1-03      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                                                            ************

Q07817_BCL2L1-02      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-03      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                      *********************************

© 1998-2019