Dataset for protein Bfl1 of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q16548_BCL2A1-01      MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
B4E1X9_BCL2A1-01      MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
Q16548_BCL2A1-02      MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
                      **************************************************

Q16548_BCL2A1-01      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
B4E1X9_BCL2A1-01      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
Q16548_BCL2A1-02      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
                      **************************************************

Q16548_BCL2A1-01      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
B4E1X9_BCL2A1-01      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWVCVMEKFF--
Q16548_BCL2A1-02      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTP--
                      ****************************************     :    

Q16548_BCL2A1-01      KSGWMTFLEVTGKICEMLSLLKQYC
B4E1X9_BCL2A1-01      -----IVLSCEIEIENFLAS-----
Q16548_BCL2A1-02      -----MLVESVAHKKRKMAL-----
                            .:.        ::      

© 1998-2019