Dataset for protein Bcl-2 of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P10415_BCL2-04      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
P10415_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
P10415_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
A9QXG9_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
                    ************************************************************

P10415_BCL2-04      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
P10415_BCL2-01      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
P10415_BCL2-02      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
A9QXG9_BCL2-01      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
                    ************************************************************

P10415_BCL2-04      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
P10415_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
P10415_BCL2-02      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
A9QXG9_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
                    ************************************************************

P10415_BCL2-04      LNRHLHTWIQDNGGW------------------------------VGALGDVSLG-----
P10415_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGAC--ITLGAYLGH
P10415_BCL2-02      LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGAC--ITLGAYLGH
A9QXG9_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGAC--ITLGAYLSH
                    ***************                              ***   ::**     

P10415_BCL2-04      -
P10415_BCL2-01      K
P10415_BCL2-02      K
A9QXG9_BCL2-01      K
                     

© 1998-2019