Dataset for protein Mcl-1 of organism Hippocampus comes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2XZL8_MCL1-01      MSMVQPTSQVLKPQGRPMRPQNGVAEGLLQCNSPPVAAASTSPPQLHRAV
A0A3Q2Y539_MCL1-01      -----------MPESKRF-PLYNFKVGLVDALMLPPKA------------
                                    *:.. : *  ..  **::.   *  *            

A0A3Q2XZL8_MCL1-01      ATLGAVNCNSGAAKPRPSALEILCKGGLAT-MNHRNNSDDDFDVESSDDS
A0A3Q2Y539_MCL1-01      ----------------------VVQGSMASQLQEVERRSDNSDMDEGAQP
                                              : :*.:*: ::  :. .*: *::.. :.

A0A3Q2XZL8_MCL1-01      PPSTPDSQDSLVADGRNDVVDAETKGLIRRFLTDFTGLSTASWNESKAHS
A0A3Q2Y539_MCL1-01      LP-------ELQTPPGQGVLDTETRRLIGRFLRDFTGLSTAAWIQSKAQS
                         *       .* :   :.*:*:**. ** *** ********:* :***:*

A0A3Q2XZL8_MCL1-01      TMKRVVAKVLEKHKYKYNGIINKLSLDDRGDNVSFISEVAKSLFSDGTTN
A0A3Q2Y539_MCL1-01      TMKRVVTRLVDKHRILFNNMVNELSLDQRGLDRSFVSQVAQTEFANGNIN
                        ******:.:::**.  :*.::*:****:** : **:*:**:: *::*. *

A0A3Q2XZL8_MCL1-01      WGRVASLVAFGAIVSQHLKEKGRAHCVEPVADEISSYLLSHQRNWLVKNN
A0A3Q2Y539_MCL1-01      WGRIASLLAFCAVLSQALKENQQERCVELVAQEVSTYLLSHQRTWLVQHN
                        ***:***:** *::** ***: . .*** **:*:*:*******.***::*

A0A3Q2XZL8_MCL1-01      SWDGFVQFFREVDPESTVRNTLMAFAGVAGIGATLALLIR
A0A3Q2Y539_MCL1-01      GWDGFAEFFKEDDLESTVRNGLFAFVGLVSVTAALRCLIR
                        .****.:**.* * ****** *:**.*:..: *:*  ***

© 1998-2019