Dataset for protein BCL-2-like of organism Hippocampus comes

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2XZL8_MCL1-01      MSMVQPTSQVLKPQGRPMRP---QNGVAEGLLQCNSPPVAAASTSPPQLH
A0A3Q2Y539_MCL1-01      -----------MPESKRFPLYNFKVGLVDALMLPPKA-------------
A0A3Q3DUT7_BCL2L1-      -----------MSQNRELVLFYIRYKLSQ----KNYP-------------
A0A3Q3DUT7_BCL2L1-      -----------MSQNRELVLFYIRYKLSQ----KNYP-------------
A0A3Q3DUT7_BCL2L1-      -----------MSQNRELVLFYIRYKLSQ----KNYP-------------
                                    .:.. :     .  : :       .             

A0A3Q2XZL8_MCL1-01      RAVATLGAVNCNSGAAKPRPSALEILCKGGLATMNHRNNSDDDFDVESSD
A0A3Q2Y539_MCL1-01      -------------------------VVQGSMASQLQEVERRSDNSDMDEG
A0A3Q3DUT7_BCL2L1-      -------------------------LNHIGLRQALNRTDGREEASGEEEQ
A0A3Q3DUT7_BCL2L1-      -------------------------LNHIGLRQALNRTDGREEASGEEEQ
A0A3Q3DUT7_BCL2L1-      -------------------------LNHIGLRQALNRTDGREEASGEEEQ
                                                 : : .:    :  :  .: .  .. 

A0A3Q2XZL8_MCL1-01      DSPPSTPDSQDSLVADGRNDVVDAETKGLIRRFLTDFTGLSTASWNESKA
A0A3Q2Y539_MCL1-01      AQPLPELQTPPG------QGVLDTETRRLIGRFLRDFTGLSTAAWIQSKA
A0A3Q3DUT7_BCL2L1-      RVQTPANGTTNG------TSPPASP--------LREAASLDA-------V
A0A3Q3DUT7_BCL2L1-      RVQTPANGTTNG------TSPPASP--------LREAASLDA-------V
A0A3Q3DUT7_BCL2L1-      RVQTPANGTTNG------TSPPASP--------LREAASLDA-------V
                            .   :  .       .   :         * : :.*.:       .

A0A3Q2XZL8_MCL1-01      HSTMKRVVAKVLEKHKYKYNGIINKLSLDDRGDNVSFISEVAKSLFSDGT
A0A3Q2Y539_MCL1-01      QSTMKRVVTRLVDKHRILFNNMVNELSLDQRGLDRSFVSQVAQTEFANGN
A0A3Q3DUT7_BCL2L1-      KEALRDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVV--DEVFQDD
A0A3Q3DUT7_BCL2L1-      KEALRDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVV--DEVFQDD
A0A3Q3DUT7_BCL2L1-      KEALRDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVV--DEVFQDD
                        :.::.  .  .  .:   :..: ::* :       ** . *    . :. 

A0A3Q2XZL8_MCL1-01      TNWGRVASLVAFGAIVSQHLKEKGRAHCVEPVADEISSYLLSHQRNWLVK
A0A3Q2Y539_MCL1-01      INWGRIASLLAFCAVLSQALKENQQERCVELVAQEVSTYLLSHQRTWLVQ
A0A3Q3DUT7_BCL2L1-      VNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWMTVYLDNHLQPWIES
A0A3Q3DUT7_BCL2L1-      VNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWMTVYLDNHLQPWIES
A0A3Q3DUT7_BCL2L1-      VNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWMTVYLDNHLQPWIES
                         ****:..*.** . :.    *:     *: : : :: ** .* . *: .

A0A3Q2XZL8_MCL1-01      NNSWDGFVQFFREVDP------ESTVRNTLMAFAGVAG--IGATLALLIR
A0A3Q2Y539_MCL1-01      HNGWDGFAEFFKEDDL------ESTVRNGLFAFVGLVS--VTAALRCLIR
A0A3Q3DUT7_BCL2L1-      QGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKR
A0A3Q3DUT7_BCL2L1-      QGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKR
A0A3Q3DUT7_BCL2L1-      QGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKR
                        :..*: *.::*           :.:..: *:* . :.   : .:*    *

A0A3Q2XZL8_MCL1-01      -
A0A3Q2Y539_MCL1-01      -
A0A3Q3DUT7_BCL2L1-      L
A0A3Q3DUT7_BCL2L1-      L
A0A3Q3DUT7_BCL2L1-      L
                         

© 1998-2019