Dataset for protein Bcl-xL of organism Hippocampus comes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3DUT7_BCL2L1-      MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQ
A0A3Q3DUT7_BCL2L1-      MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQ
A0A3Q3DUT7_BCL2L1-      MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQ
                        **************************************************

A0A3Q3DUT7_BCL2L1-      TPANGTTNGTSPPASPLREAASLDAVKEALRDSANEFELRYSHAFSDLDK
A0A3Q3DUT7_BCL2L1-      TPANGTTNGTSPPASPLREAASLDAVKEALRDSANEFELRYSHAFSDLDK
A0A3Q3DUT7_BCL2L1-      TPANGTTNGTSPPASPLREAASLDAVKEALRDSANEFELRYSHAFSDLDK
                        **************************************************

A0A3Q3DUT7_BCL2L1-      QLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMI
A0A3Q3DUT7_BCL2L1-      QLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMI
A0A3Q3DUT7_BCL2L1-      QLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMI
                        **************************************************

A0A3Q3DUT7_BCL2L1-      PLVDRIIEWMTVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESF
A0A3Q3DUT7_BCL2L1-      PLVDRIIEWMTVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESF
A0A3Q3DUT7_BCL2L1-      PLVDRIIEWMTVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESF
                        **************************************************

A0A3Q3DUT7_BCL2L1-      KKWLLAGVTLVTGVVVGSLIAQKRL
A0A3Q3DUT7_BCL2L1-      KKWLLAGVTLVTGVVVGSLIAQKRL
A0A3Q3DUT7_BCL2L1-      KKWLLAGVTLVTGVVVGSLIAQKRL
                        *************************

© 1998-2019