Dataset for protein BCL-2-like of organism Haplochromis burtoni

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2UYW8_BCL2-01      -MANEYNRNIVEKYICHKLSKRGFVWGFRVVQEEDAANNGSIT--DPPPT
A0A3Q2X557_BCL2L1-      ---MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQR
A0A3Q2VNL8_MCL1-01      MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQ------NATGS
A0A3Q2UUP0_BCL2L10      -MIYGLFVTLFCTIPNHDHTSAGY---SVAVVSSFHSPH------DVPST
A0A3Q2UUP0_BCL2L10      -MIYGLFVTLFCTIPNHDHTSAGY---SVAVVSSFHSPH------DVPST
                                        :  .. .         .            :    

A0A3Q2UYW8_BCL2-01      LVHRCREASTGPDGESNTHLCRRLPQS-----------------------
A0A3Q2X557_BCL2L1-      IDTHANGTFNGTSPGTPPASPQRRQQQ-----------------------
A0A3Q2VNL8_MCL1-01      SKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDREEDGSLPSTPEFHS
A0A3Q2UUP0_BCL2L10      KIMSRGGVTHSASAEGKTQLYRRSPSA----VCMCREQSDIAGRKMKFCG
A0A3Q2UUP0_BCL2L10      KIMSRGGVTHSASAEGKTQLYRRSPSA----VCMCREQSDIAGRKMKFCG
                                  .              .                        

A0A3Q2UYW8_BCL2-01      -------------------------------DPHA----GIHRVLREAGD
A0A3Q2X557_BCL2L1-      -------------------------------PPSTTDLDAVKEALRDTAN
A0A3Q2VNL8_MCL1-01      DSESDEQLERETKLLIHSFLG-DFTGLSQPQRKET----KALKTMKRVVA
A0A3Q2UUP0_BCL2L10      -------LWKETLVLAEDYLSFCCTSPHQAPPPPS----ESAAAMRRLGW
A0A3Q2UUP0_BCL2L10      -------LWKETLVLAEDYLSFCCTSPHQAPPPPS----ESAAAMRRLGW
                                                          :        .:.    

A0A3Q2UYW8_BCL2-01      ELERLYQPDFTEMSRQLHLTSATAQ-RRFAEVIDELFRDG-VNWGRIIAF
A0A3Q2X557_BCL2L1-      EFELRYARAFSDLHSQLHITPATAY-QSFENVMDEVFRDG-VNWGRIVGL
A0A3Q2VNL8_MCL1-01      DVLEKHRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSF
A0A3Q2UUP0_BCL2L10      DIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSL
A0A3Q2UUP0_BCL2L10      DIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSL
                        :.   :   :  :   : :         .  * ..:. *   ****::.:

A0A3Q2UYW8_BCL2-01      FEFGGTVCVECA-----------SNEGMSSQ-VDNIADWMTEYLNGPLNS
A0A3Q2X557_BCL2L1-      FAFGGALCVECV-----------EKE-MSPL-VGRIVEWMTVYLDNHIQP
A0A3Q2VNL8_MCL1-01      MAFGAVVSQHL------------KEKGRDNY-VALVSQEISAYLLSEQRD
A0A3Q2UUP0_BCL2L10      FAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKD
A0A3Q2UUP0_BCL2L10      FAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEKKD
                        : * ..:.               .:   .      : : :: **    . 

A0A3Q2UYW8_BCL2-01      WIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYL
A0A3Q2X557_BCL2L1-      WIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALI
A0A3Q2VNL8_MCL1-01      WIVKNNAWDGFVEFFRVA---DPESIVR--HTLMAFAGFAGIGATLALLI
A0A3Q2UUP0_BCL2L10      WLLDNDGWEGFCKFSRSAREVSQDSSMK--KALFAAAGVGLAGLTFLLVR
A0A3Q2UUP0_BCL2L10      WLLDNDGWEGFCKFSRSAREVSQDSSMK--KALFAAAGVGLAGLTFLL--
                        *: .:..*: * ::                :  :  .     . .     

A0A3Q2UYW8_BCL2-01      TQK--
A0A3Q2X557_BCL2L1-      AQKRL
A0A3Q2VNL8_MCL1-01      SGL--
A0A3Q2UUP0_BCL2L10      -----
A0A3Q2UUP0_BCL2L10      -----
                             

© 1998-2019