Dataset for protein Bcl2l10 of organism Haplochromis burtoni

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2UUP0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
A0A3Q2UUP0_BCL2L10      MIYGLFVTLFCTIPNHDHTSAGYSVAVVSSFHSPHDVPSTKIMSRGGVTH
                        **************************************************

A0A3Q2UUP0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
A0A3Q2UUP0_BCL2L10      SASAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLVLAEDYLS
                        **************************************************

A0A3Q2UUP0_BCL2L10      FCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDH
A0A3Q2UUP0_BCL2L10      FCCTSPHQAPPPPSESAAAMRRLGWDIERQHQARFDNLAQTFLVQCGPDH
                        **************************************************

A0A3Q2UUP0_BCL2L10      CLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQE
A0A3Q2UUP0_BCL2L10      CLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPRQQQE
                        **************************************************

A0A3Q2UUP0_BCL2L10      LGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFSRSAREVSQDS
A0A3Q2UUP0_BCL2L10      LGQEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFSRSAREVSQDS
                        **************************************************

A0A3Q2UUP0_BCL2L10      SMKKALFAAAGVGLAGLTFLLVR
A0A3Q2UUP0_BCL2L10      SMKKALFAAAGVGLAGLTFLL--
                        *********************  

© 1998-2019