Dataset for protein Mcl-1 of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YQH7_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL--------------
A0A2I2YQH7_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2I2YQH7_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
                        ************************************              

A0A2I2YQH7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-02      GEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFA
A0A2I2YQH7_MCL1-01      GEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFA
                                                                          

A0A2I2YQH7_MCL1-03      --------------------------------------------------
A0A2I2YQH7_MCL1-02      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2I2YQH7_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
                                                                          

A0A2I2YQH7_MCL1-03      ---------------------------------------ATGAKDTKPMG
A0A2I2YQH7_MCL1-02      GNDTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2I2YQH7_MCL1-01      GNDTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
                                                               ***********

A0A2I2YQH7_MCL1-03      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A2I2YQH7_MCL1-02      RSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV---------------
A0A2I2YQH7_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        ****************************** :  :               

A0A2I2YQH7_MCL1-03      IHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A2I2YQH7_MCL1-02      --LPCRGPRRW---------------------HQECAAGFCRCCWS----
A0A2I2YQH7_MCL1-01      IHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                          : . *  .*                     ::.*   :. .  .    

A0A2I2YQH7_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2I2YQH7_MCL1-02      --RSWF---------------------------------GISNKIALL--
A0A2I2YQH7_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                          *.*:                                 *:.  :* *  

© 1998-2019