Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3RY91_BCL2L1-02        --------------------------------------------------
A0A2I2YPX6_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKG------YVCGAGPGEGP-AADPLH
A0A2I2YQH7_MCL1-02      ------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPG
A0A2I2YQH7_MCL1-01      ------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPG
G3QES9_BCL2-01          ---------------------------------------MAHAGRTGYDN
G3RY91_BCL2L1-01        ---------------------------------------------MSQSN
A0A2I2YPX6_BCL2L2-      ----------------------------------------MATPASAPDT
G3QLU6_BCL2L10-01       -------------------------------MVDQWRERTTMADPLRERT
A0A2I2YQH7_MCL1-03      ------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPG
A0A2I2YML2_BCL2A1-      --------------MTDCEFGY---------IY-----------------
A0A2I2YML2_BCL2A1-      --------------MTDCEFGY---------IY-----------------
A0A2I2YML2_BCL2A1-      --------------MTDCEFGY---------IY-----------------
                                                                          

G3RY91_BCL2L1-02        --------------------------------------------------
A0A2I2YPX6_BCL2L2-      QAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNW
A0A2I2YQH7_MCL1-02      GRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPI
A0A2I2YQH7_MCL1-01      GRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPI
G3QES9_BCL2-01          REIVMKYIHYKLSQRGYEWD-----AGDVGAVPPGAAPAPGIFSSQPGHT
G3RY91_BCL2L1-01        RELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNP
A0A2I2YPX6_BCL2L2-      RALVADFVGYKLRQKGYVCG------------------------------
G3QLU6_BCL2L10-01       ERLLADYLGYCAREPG---T------------------------------
A0A2I2YQH7_MCL1-03      GRLLATGAKDTKPMG----R------------------------------
A0A2I2YML2_BCL2A1-      -RLAQDYLQYVLQIP----Q------------------------------
A0A2I2YML2_BCL2A1-      -RLAQDYLQYVLQIP----Q------------------------------
A0A2I2YML2_BCL2A1-      -RLAQDYLQYVLQIP----Q------------------------------
                                                                          

G3RY91_BCL2L1-02        --------------------------------------------------
A0A2I2YPX6_BCL2L2-      GRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGG
A0A2I2YQH7_MCL1-02      GAEV-------------------PDVTATPARLLFFAPTRRAAPLEEMEA
A0A2I2YQH7_MCL1-01      GAEV-------------------PDVTATPARLLFFAPTRRAAPLEEMEA
G3QES9_BCL2-01          PHPA----------------------------------------------
G3RY91_BCL2L1-01        SWHL----------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
                                                                          

G3RY91_BCL2L1-02        --------------------------------------------------
A0A2I2YPX6_BCL2L2-      WELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEK
A0A2I2YQH7_MCL1-02      PAADAIMSPEEELD-----------------GYEPEPLGKRPAVLPLLEL
A0A2I2YQH7_MCL1-01      PAADAIMSPEEELD-----------------GYEPEPLGKRPAVLPLLEL
G3QES9_BCL2-01          --------------------------------------------------
G3RY91_BCL2L1-01        --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
                                                                          

G3RY91_BCL2L1-02        --------------------------------------------------
A0A2I2YPX6_BCL2L2-      MEADARSIYVGNV--DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKG
A0A2I2YQH7_MCL1-02      VGESGNDTSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQATG
A0A2I2YQH7_MCL1-01      VGESGNDTSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQATG
G3QES9_BCL2-01          -----------------------------ASRDRVARTSPLQTPAAPGAA
G3RY91_BCL2L1-01        -----------------------------A-----------DSPAVNGAT
A0A2I2YPX6_BCL2L2-      ----------------------------------------------AGPG
G3QLU6_BCL2L10-01       ----------------------------------------------PEPT
A0A2I2YQH7_MCL1-03      ----------------------------------------------SGAT
A0A2I2YML2_BCL2A1-      ----------------------------------------------PGSG
A0A2I2YML2_BCL2A1-      ----------------------------------------------PGSG
A0A2I2YML2_BCL2A1-      ----------------------------------------------PGSG
                                                                          

G3RY91_BCL2L1-02        -------------------MWKRTGLRPQKGLNRRWRPPVPSMATHPGTA
A0A2I2YPX6_BCL2L2-      FAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAIICSSLTQV------I
A0A2I2YQH7_MCL1-02      AKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV-------
A0A2I2YQH7_MCL1-01      AKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDD
G3QES9_BCL2-01          AGPALSPVPPVVHL-----TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTA
G3RY91_BCL2L1-01        GHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTA
A0A2I2YPX6_BCL2L2-      EGPAADPLHQAMRA---------AGDEFETRFRRTFSDLAAQLHVTPGSA
G3QLU6_BCL2L10-01       PSTPEAAVLRSAAA---------RLRQIHRSFFSAYLGYPG---NRFELV
A0A2I2YQH7_MCL1-03      SRKALETLRRVGDG---------VQRNHETAFQGMLRKLDI---KNEDDV
A0A2I2YML2_BCL2A1-      PSKTSRVLQKVAFS---------VQKEVEKNLKSCLDNVNV---VSIDTA
A0A2I2YML2_BCL2A1-      PSKTSRVLQKVAFS---------VQKEVEKNLKSCLDNVNV---VSIDTA
A0A2I2YML2_BCL2A1-      PSKTSRVLQKVAFS---------VQKEVEKNLKSCLDNVNV---VSIDTA
                                                                          

G3RY91_BCL2L1-02        YQSFEQVVNELFRDGV-NWGRIVAFFSFGGALCVE---------------
A0A2I2YPX6_BCL2L2-      PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF---------------
A0A2I2YQH7_MCL1-02      ----------LPCRGPRRW-------------------------------
A0A2I2YQH7_MCL1-01      VKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKH---------------
G3QES9_BCL2-01          RGRFATVVEELFRDGV-NWGRIVAFFEFGGVMCVE---------------
G3RY91_BCL2L1-01        YQSFEQVVNELFRDGV-NWGRIVAFFSFGGALCVE---------------
A0A2I2YPX6_BCL2L2-      QQRFTQVSDELFQGGP-NWGRLVAFFVFGAALCAE---------------
G3QLU6_BCL2L10-01       ALMADSVLSDSPGP---TWGRVVTLVTFAGTLLERGPLVTARWKKWGFQP
A0A2I2YQH7_MCL1-03      KSL-SRVMIHVFSDGVTNWGRIVTLISFGAFVAKH---------------
A0A2I2YML2_BCL2A1-      RTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKK---------------
A0A2I2YML2_BCL2A1-      RTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKK---------------
A0A2I2YML2_BCL2A1-      RTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKK---------------
                                                                          

G3RY91_BCL2L1-02        SVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWD-TFVELYGNNA
A0A2I2YPX6_BCL2L2-      ---YSGFNSRPRGRVYRGRARA------TSWYSPY---------------
A0A2I2YQH7_MCL1-02      --------HQECAAGFCRCCWS------RSWF------------------
A0A2I2YQH7_MCL1-01      ---LKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED
G3QES9_BCL2-01          SVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPSM
G3RY91_BCL2L1-01        SVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWD-TFVELYGNNA
A0A2I2YPX6_BCL2L2-      SVNKEMEPLVGQVQE---WMVAYLETRLADWIHSSGGWA-EFTALYGDGA
G3QLU6_BCL2L10-01       RLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWD-GFCHFFRTPF
A0A2I2YQH7_MCL1-03      L---KTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED
A0A2I2YML2_BCL2A1-      LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK----------
A0A2I2YML2_BCL2A1-      LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP--
A0A2I2YML2_BCL2A1-      LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP--
                                                      *                   

G3RY91_BCL2L1-02        AAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK----------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YQH7_MCL1-02      ------------------------GISNKIALL-----------------
A0A2I2YQH7_MCL1-01      LEGGIRNVLL--------AFAGVAGVGAGLAYLIR---------------
G3QES9_BCL2-01          -------RPLFDFSWLSLKTLLSLALVGACITLGAYLGHK----------
G3RY91_BCL2L1-01        AAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK----------
A0A2I2YPX6_BCL2L2-      LEEARRLREG--------NWASVRTVLTGAVALGALVTVGAFFASK----
G3QLU6_BCL2L10-01       PLAFWRKQLV--------QAFLSCLLATAFIYLWTRLL------------
A0A2I2YQH7_MCL1-03      LEGGIRNVLL--------AFAGVAGVGAGLAYLIR---------------
A0A2I2YML2_BCL2A1-      -------------------WHNHTPMLVESVAHKKRKMAL----------
A0A2I2YML2_BCL2A1-      -----KSGWM--------TFLEVTGKICEMLSLLKQ-YC-----------
A0A2I2YML2_BCL2A1-      -----KSGWM--------TFLEVTGKISILLTRKDTPYCETGLIFLTVME
                                                                          

G3RY91_BCL2L1-02        ---------
A0A2I2YPX6_BCL2L2-      ---------
A0A2I2YQH7_MCL1-02      ---------
A0A2I2YQH7_MCL1-01      ---------
G3QES9_BCL2-01          ---------
G3RY91_BCL2L1-01        ---------
A0A2I2YPX6_BCL2L2-      ---------
G3QLU6_BCL2L10-01       ---------
A0A2I2YQH7_MCL1-03      ---------
A0A2I2YML2_BCL2A1-      ---------
A0A2I2YML2_BCL2A1-      ---------
A0A2I2YML2_BCL2A1-      TIANTYFYF
                                 

© 1998-2019