Dataset for protein Bcl-xL of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3RY91_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
G3RY91_BCL2L1-02      --------------------------------------------------
                                                                        

G3RY91_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
G3RY91_BCL2L1-02      -----MWKRTGLRPQKG-----------------------------LNRR
                            *: :.  . :*                             :: *

G3RY91_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
G3RY91_BCL2L1-02      WRPPVPSMATH----PGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      :* ....::::    ***********************************

G3RY91_BCL2L1-01      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
G3RY91_BCL2L1-02      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                      **************************************************

G3RY91_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
G3RY91_BCL2L1-02      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                      *********************************

© 1998-2019