Dataset for protein Bfl1 of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YML2_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEK
A0A2I2YML2_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEK
A0A2I2YML2_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEK
                        **************************************************

A0A2I2YML2_BCL2A1-      NLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2I2YML2_BCL2A1-      NLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2I2YML2_BCL2A1-      NLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
                        **************************************************

A0A2I2YML2_BCL2A1-      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK--------
A0A2I2YML2_BCL2A1-      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
A0A2I2YML2_BCL2A1-      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
                        **************************************** :        

A0A2I2YML2_BCL2A1-      ------WHNHTPMLVESVAHKKRKMAL-------------------
A0A2I2YML2_BCL2A1-      KSGWMTFLEVTGKICEMLSLLKQ-YC--------------------
A0A2I2YML2_BCL2A1-      KSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
                              : : *  :   ::  .   .                    

© 1998-2019