Dataset for protein BCL-2-like of organism Gopherus agassizii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452J3N6_BCL2A1-      MESSEYCYVYY---------------------LVQDYLKYVLQ-------
A0A452I9V7_BCL2-01      MYLTACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWA
A0A452ILL8_BCL2L1-      -------------------------MSNTNRELVIDFLSYKLSQRGYSWS
A0A452ILL8_BCL2L1-      -------------------------MSNTNRELVIDFLSYKLSQRGYSWS
                                                        :* .:: * *.       

A0A452J3N6_BCL2A1-      --------------------------------------------------
A0A452I9V7_BCL2-01      ANENRGPVSPNLSPPTVTGTSSDHAGLMSLPPEPPG----------SAAA
A0A452ILL8_BCL2L1-      RFEGEDEIRTD---------SAEEAEMASVPNGSPSWHPGASHIVNGAAG
A0A452ILL8_BCL2L1-      RFEGEDEIRTD---------SAEEAEMASVPNGSPSWHPGASHIVNGAAG
                                                                          

A0A452J3N6_BCL2A1-      -----EPQLGPAPSRVAHVLRHAASFLQKENEESLKPCLDTFDITSVDAA
A0A452I9V7_BCL2-01      SNVPLGDGLRPAPQAVLLALCQAGDEFSRRYHRDFAQMSGQLHLTPFTAR
A0A452ILL8_BCL2L1-      HSNSLEAHERVPATGVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
A0A452ILL8_BCL2L1-      HSNSLEAHERVPATGVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
                                   ..  *  .*  *.. :.      :    . : :*.  * 

A0A452J3N6_BCL2A1-      RRIFTQVMDKEFADGNTNWGRILTIFMFGGILSKKLQEHRVQLTGENKKQ
A0A452I9V7_BCL2-01      GR-FVAVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVD---S
A0A452ILL8_BCL2L1-      QS-FEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVG---R
A0A452ILL8_BCL2L1-      QS-FEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVG---R
                           *  *::: * ** .*****:::* *** :. :  :. :.        

A0A452J3N6_BCL2A1-      ISYFITEYIINTKAEWIEANGGWENGFLTMF------------EEKRSWL
A0A452I9V7_BCL2-01      IAVWMTEYLNRHLHNWIQDNGGWVC-VQYFF-------------------
A0A452ILL8_BCL2L1-      IVSWMTTYLTDHLDPWIQENGGWER-FVDLYGNDAAAKSRKGQEQFNRWL
A0A452ILL8_BCL2L1-      IVSWMTTYLTDHLDPWIQENGGWER-FVDLYGNDAAAKSRKGQEQFNRWL
                        *  ::* *:      **: ****   .  ::                   

A0A452J3N6_BCL2A1-      SLFNIKAKIMDAFSFFSQYY
A0A452I9V7_BCL2-01      --------------LFKLQ-
A0A452ILL8_BCL2L1-      LTGATLAGVLLLGSLLSRK-
A0A452ILL8_BCL2L1-      LTGATLAGVLLLGSLLSRK-
                                      ::.   

© 1998-2019