Dataset for protein Bcl-xL of organism Gopherus agassizii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452ILL8_BCL2L1-      MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAEEAEMASVPNGS
A0A452ILL8_BCL2L1-      MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAEEAEMASVPNGS
                        **************************************************

A0A452ILL8_BCL2L1-      PSWHPGASHIVNGAAGHSNSLEAHERVPATGVRQALREAGDEFELRYRRA
A0A452ILL8_BCL2L1-      PSWHPGASHIVNGAAGHSNSLEAHERVPATGVRQALREAGDEFELRYRRA
                        **************************************************

A0A452ILL8_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
A0A452ILL8_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
                        **************************************************

A0A452ILL8_BCL2L1-      VDKEMQVLVGRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSR
A0A452ILL8_BCL2L1-      VDKEMQVLVGRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSR
                        **************************************************

A0A452ILL8_BCL2L1-      KGQEQFNRWLLTGATLAGVLLLGSLLSRK
A0A452ILL8_BCL2L1-      KGQEQFNRWLLTGATLAGVLLLGSLLSRK
                        *****************************

© 1998-2019