Dataset for protein BCL-2-like of organism Gasterosteus aculeatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3PJT0_MCL1-01        MNIIQRPKLAALNMTGVMSCIILPQNGVAPMRQLAMGSAKDSHNGNAGTN
G3NJY1_BCL2L1-01      -MSQNR-ELVVFYINYKLSQRNLPLNHIGL---------SEPPNRTGGGV
G3P7B4_BCL2L1-01      MANINR-ELVEFFLSYKLSQKNHPTSLLRP---------EDAGGRTEGDK
                          :* :*. : :.  :*    * . :           .:. . . *  

G3PJT0_MCL1-01        DTPKRPSALGVNSANGYPSKPQREDSEDTDNDSLPCTPESDSETDVSDSP
G3NJY1_BCL2L1-01      EAGAAGGQRGATHSNG------------TFNGTSPGTPPASPLLQQRSPS
G3P7B4_BCL2L1-01      ANSASVPGRGSSAGQ-------------------PGMSSPPP------PP
                               * . .:                   *  . . .      ..

G3PJT0_MCL1-01        AGA-----AALESDTRQLLGRFLREFTGLS-KTQWNPSRELTTMKRVVGD
G3NJY1_BCL2L1-01      TASLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFEDVMDE
G3P7B4_BCL2L1-01      SGDTEAVKAALQDSANEFELLFTQAFSDLSLQLDVTPDTAYHSFKSVMDE
                      :.       ** ..:.::   : . *:.*  :   .*     ::: *:.:

G3PJT0_MCL1-01        VLEKHRYVFNGMVNKLSLDDRGDDASFVREVATSLFADGTTNWGRIASLV
G3NJY1_BCL2L1-01      V----------------------------------FRDG-VNWGRIVGLF
G3P7B4_BCL2L1-01      V----------------------------------FKDG-VNWGRVVGLF
                      *                                  * ** .****:..*.

G3PJT0_MCL1-01        AFGAVVCQHLAERGRGNCVELVGQEISAYLLSDQRDWLIKNNAWVGFVEF
G3NJY1_BCL2L1-01      AFGGALCVECVDKEMSPLVGRIVEWMTLYLDNHIQPWIQNQGGWR--SDI
G3P7B4_BCL2L1-01      AFGGVLCVECVEKDMTELVSRIADWMTTYLDEHISAWIQSQGGWDCFADI
                      ***..:*   .:.     *  : : :: ** .    *: .:..*    ::

G3PJT0_MCL1-01        FRVADPESAVRNTLMAVAGFASIGATLALLISGPSKVQRQLLTIELLQIV
G3NJY1_BCL2L1-01      --------------------------------------------------
G3P7B4_BCL2L1-01      FGRDGAAAARRSQETMRRWLLVGVALLMGVLVGMVMVKKR----------
                                                                        

G3PJT0_MCL1-01        RSQRGGHRLQRDVSTRPSPTSGSGL
G3NJY1_BCL2L1-01      -------------------------
G3P7B4_BCL2L1-01      -------------------------
                                               

© 1998-2019