Dataset for protein Bcl-xL of organism Gasterosteus aculeatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3NJY1_BCL2L1-01      -MSQNRELVVFYINYKLSQRNLPLNHIGLSEPPNRTGGGVEAGAAGGQRG
G3P7B4_BCL2L1-01      MANINRELVEFFLSYKLSQKNHPTSLLRPEDAGGRTEGDKANSASVPGRG
                        . ***** *::.*****.* * . :  .:. .** *.   .*:   **

G3NJY1_BCL2L1-01      ATHSNGTFNGTSPGTPPASPLLQQRSPSTASLDAVKEALRDSANEFELRY
G3P7B4_BCL2L1-01      SSAGQ-------PGMSSPPP------PPSGDTEAVKAALQDSANEFELLF
                      :: .:       ** ....*      *.:.. :*** **.******** :

G3NJY1_BCL2L1-01      ARAFSDLHNQLHITPATAYQSFEDVMDEVFRDGVNWGRIVGLFAFGGALC
G3P7B4_BCL2L1-01      TQAFSDLSLQLDVTPDTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGGVLC
                      :.*****  ** :** ***:**:.******.*******:********.**

G3NJY1_BCL2L1-01      VECVDKEMSPLVGRIVEWMTLYLDNHIQPWIQNQGGWR--SDI-------
G3P7B4_BCL2L1-01      VECVEKDMTELVSRIADWMTTYLDEHISAWIQSQGGWDCFADIFGRDGAA
                      ****:*:*: **.**.:*** ***:**..***.****   :**       

G3NJY1_BCL2L1-01      ---------------------------------
G3P7B4_BCL2L1-01      AARRSQETMRRWLLVGVALLMGVLVGMVMVKKR
                                                       

© 1998-2019