Dataset for protein BCL-2-like of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1L1RNM6_MCL1-01      ------MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAA
A0A1L1RNM6_MCL1-02      ------MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAA
Q9W6F2_BCL2A1-01        --METAEFYYVYYLAQDYLQY-----------------------------
Q00709_BCL2-01          MAHPGRRGYDNREIVLKYIHY-----------------------------
Q07816_BCL2L1-04        ------MSSSNRELVIDFVSY-----------------------------
Q07816_BCL2L1-01        ------MSSSNRELVIDFVSY-----------------------------
Q07816_BCL2L1-03        ------MSSSNRELVIDFVSY-----------------------------
Q07816_BCL2L1-02        ------MSSSNRELVIDFVSY-----------------------------
                                      .  :  *                             

A0A1L1RNM6_MCL1-01      AATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAARRAP
A0A1L1RNM6_MCL1-02      AATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAARRAP
Q9W6F2_BCL2A1-01        ---------VLQ--------------------------------------
Q00709_BCL2-01          ---------KLSQRGYDWAAGEDRPPVPPAPAPAAAPAAVAAAGASSHHR
Q07816_BCL2L1-04        ---------KLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWH--
Q07816_BCL2L1-01        ---------KLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWH--
Q07816_BCL2L1-03        ---------KLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWH--
Q07816_BCL2L1-02        ---------KLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWH--
                                  *                                       

A0A1L1RNM6_MCL1-01      PDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQ
A0A1L1RNM6_MCL1-02      PDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQ
Q9W6F2_BCL2A1-01        -------------------------------------------ESHLGPA
Q00709_BCL2-01          PE-------------------------PPGSAAASEVPPAEGLR----PA
Q07816_BCL2L1-04        -P-------------------------PAGHVVNGATVHRSSLEVHEIVR
Q07816_BCL2L1-01        -P-------------------------PAGHVVNGATVHRSSLEVHEIVR
Q07816_BCL2L1-03        -P-------------------------PAGHVVNGATVHRSSLEVHEIVR
Q07816_BCL2L1-02        -P-------------------------PAGHVVNGATVHRSSLEVHEIVR
                                                                          

A0A1L1RNM6_MCL1-01      ESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKALETL
A0A1L1RNM6_MCL1-02      ESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKALETL
Q9W6F2_BCL2A1-01        QT------------------------------------------RVAHVL
Q00709_BCL2-01          PP------------------------------------------GVHLAL
Q07816_BCL2L1-04        AS------------------------------------------DVRQAL
Q07816_BCL2L1-01        AS------------------------------------------DVRQAL
Q07816_BCL2L1-03        AS------------------------------------------DVRQAL
Q07816_BCL2L1-02        AS------------------------------------------DVRQAL
                         .                                           .  .*

A0A1L1RNM6_MCL1-01      RRVGDGVMQKHELAFQGMLRKLEIKK-EDDLQAVCEVAAHVFNDGVTNWG
A0A1L1RNM6_MCL1-02      RRVGDGVMQKHELAFQGMLRKLEIKK-EDDLQAVCEVAAHVFNDGVTNWG
Q9W6F2_BCL2A1-01        RNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTNWG
Q00709_BCL2-01          RQAGDEFSRRYQRDFAQMSGQLHLTP-FTAHGRFVAVVEELFRDG-VNWG
Q07816_BCL2L1-04        RDAGDEFEL--RGFVRGERGQGDAGT-GGTHCVLDDHVLDRPSRS-LDPG
Q07816_BCL2L1-01        RDAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFHDG-VNWG
Q07816_BCL2L1-03        RDAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFHDG-VNWG
Q07816_BCL2L1-02        RDAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFHDG-VNWG
                        *  .. .       .     .            .          .  : *

A0A1L1RNM6_MCL1-01      RVVTLISFGAFVAKH--------LKSINQEKCITS--------LAGIITD
A0A1L1RNM6_MCL1-02      RVVTLISFGAFVAKH--------LKSINQEKCITS--------LAGIITD
Q9W6F2_BCL2A1-01        RIMTIFTFGGLLT----------KKLQEHGVQLTG---EEKEKISYFITE
Q00709_BCL2-01          RIVAFFEFGGVMC----------VESVNREMSPLV------DNIATWMTE
Q07816_BCL2L1-04        EWRL-----GALCGSVWEQRCCRAEEGPGDLQQMAPHRGDRGRSAS-AGI
Q07816_BCL2L1-01        RIVAFFSFGGALC----------VESVDKEMRVLV------GRIVSWMTT
Q07816_BCL2L1-03        RIVAFFSFGGALC----------VESVDKEMRVLV------GRIVSWMTT
Q07816_BCL2L1-02        RIVAFFSFGGALC----------VESVDKEMRVLV------GRIVSWMTT
                                 . :            :                         

A0A1L1RNM6_MCL1-01      ALVSSKREWLMS-QGGWEG-FVDFFRVEDL------ESSIRNVLMAFAGV
A0A1L1RNM6_MCL1-02      ALVSSKREWLMS-QGGWEG-FVDFFRVEDL------ESSIRNVLMAFAGV
Q9W6F2_BCL2A1-01        YIINNKAAWIDA-NGGWENGFLTKFERRSP--------------LSFSTI
Q00709_BCL2-01          YLNRHLHNWIQD-NGGWDA-FVELYGNSMRPLFDFSWISLKT-ILSLVLV
Q07816_BCL2L1-04        PAEPQVTPWLCPLAPGWLR-L----------------HTSTTQLPSTITI
Q07816_BCL2L1-01        YLTDHLDPWIQE-NGGWER-FVDLYGNNAAAELRKGQETFNKWLLTGATV
Q07816_BCL2L1-03        YLTDHLDPWIQE-NGGWER-FVDLYGNNAAAELRKGQETFNKWLLTGATV
Q07816_BCL2L1-02        YLTDHLDPWIQE-NGGWER-FVDLYGNNAAAELRKGQETFNKWLLTGATV
                                *:     **   :                        :   :

A0A1L1RNM6_MCL1-01      AGLGASLAYMIRKWRS----
A0A1L1RNM6_MCL1-02      AGLGASLAYMIR--------
Q9W6F2_BCL2A1-01        TDIFAAVLSLFREYH-----
Q00709_BCL2-01          GACITLGAYLGHK-------
Q07816_BCL2L1-04        TGRSPRSTELPSSRRQLLLS
Q07816_BCL2L1-01        AGVLLLGSLLSRK-------
Q07816_BCL2L1-03        AGVLLLGSLLSRK-------
Q07816_BCL2L1-02        AGVLLLGSLLSRK-------
                                 :          

© 1998-2019