Dataset for protein Bcl-xL of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q07816_BCL2L1-04      MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGS
Q07816_BCL2L1-01      MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGS
Q07816_BCL2L1-03      MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGS
Q07816_BCL2L1-02      MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGS
                      **************************************************

Q07816_BCL2L1-04      PSWHPPAGHVVNGATVHRSSLEVHEIVRASDVRQALRDAGDEFEL--RGF
Q07816_BCL2L1-01      PSWHPPAGHVVNGATVHRSSLEVHEIVRASDVRQALRDAGDEFELRYRRA
Q07816_BCL2L1-03      PSWHPPAGHVVNGATVHRSSLEVHEIVRASDVRQALRDAGDEFELRYRRA
Q07816_BCL2L1-02      PSWHPPAGHVVNGATVHRSSLEVHEIVRASDVRQALRDAGDEFELRYRRA
                      *********************************************  *  

Q07816_BCL2L1-04      VRGERGQGDAGTGGTHCVLDDHVLDRPSRSLDPGEWRL-----GALCGSV
Q07816_BCL2L1-01      FSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALC---
Q07816_BCL2L1-03      FSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALC---
Q07816_BCL2L1-02      FSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALC---
                      . .  .*    .* ::  ::: * :    .:: *         ****   

Q07816_BCL2L1-04      WEQRCCRAEEGPGDLQQMAPHRGDRGRSAS-AGIPAEPQVTPWLCPLAPG
Q07816_BCL2L1-01      -------VESVDKEMRVLV------GRIVSWMTTYLTDHLDPWIQE-NGG
Q07816_BCL2L1-03      -------VESVDKEMRVLV------GRIVSWMTTYLTDHLDPWIQE-NGG
Q07816_BCL2L1-02      -------VESVDKEMRVLV------GRIVSWMTTYLTDHLDPWIQE-NGG
                             .*.   ::. :.      ** .*        :: **:     *

Q07816_BCL2L1-04      WLRL----------------HTSTTQLPSTITITGRSPRSTELPSSRRQL
Q07816_BCL2L1-01      WERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK----
Q07816_BCL2L1-03      WERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK----
Q07816_BCL2L1-02      WERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK----
                      * *:                 * ...* :  *::*    .: *. .    

Q07816_BCL2L1-04      LLS
Q07816_BCL2L1-01      ---
Q07816_BCL2L1-03      ---
Q07816_BCL2L1-02      ---
                         

© 1998-2019