Dataset for protein BCL-2-like of organism Gadus morhua

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


D2ITA0_MCL1-03         MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLM
D2ITA0_MCL1-04         MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLM
D2IT42_BCL2L10-02      --------------------------------------------------
D2ITA2_BCL2L1-02       ---------------------------------MSIDTSMSISNRELVFF
                                                                         

D2ITA0_MCL1-03         ATFKSGDERKPRPTELGRGRLVNKSQDDQEGNGSLPSTPELQSEVDTDSQ
D2ITA0_MCL1-04         ATFKSGDERKPRPTELGRGRLVNKSQDDQEGNGSLPSTPELQSEVDTDSQ
D2IT42_BCL2L10-02      ----------------------------MSCR------------------
D2ITA2_BCL2L1-02       FLSHKLSQRNYRPIPFQPEGAGEGTDEDKSNR------------------
                                                    . .                  

D2ITA0_MCL1-03         AGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRV----VDGV
D2ITA0_MCL1-04         AGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRV----VDGV
D2IT42_BCL2L10-02      -----LWKETLALSEDYLLSCTASTGTAPPPPSESAAAMRGL----AQDM
D2ITA2_BCL2L1-02       -----IGNNGLRLNDG-----NGNGQLAPSPTPQGTEAVRAALLESVEEF
                            : ::   :         .      .   :   ::*      .: .

D2ITA0_MCL1-03         LEKHQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVA
D2ITA0_MCL1-04         LEKHQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVA
D2IT42_BCL2L10-02      ERQHYARFQALAQSFLAQCEADACAGLRKVMEELVGDGQLNWGRVVSLFT
D2ITA2_BCL2L1-02       ELRYTLAFSDLSSQ-LPITPATAYGSFESVMDEVFRDS-INWGRIVGLFA
                         .:   :. : ..      .   . . .* ..:. *.  ****:..*.:

D2ITA0_MCL1-03         FGAALCQYLEARGKEGC-----------------VSLVAEEISSYLLSDQ
D2ITA0_MCL1-04         FGAALCQYLEARGKEGC-----------------VSLVAEEISSYLLSDQ
D2IT42_BCL2L10-02      FTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGLAETIADYLGEEK
D2ITA2_BCL2L1-02       FGGALCVECVEKEMSHM-----------------VPRVAEWMTRYLDDHI
                       * ..*.     .                         :** :: ** .  

D2ITA0_MCL1-03         REWLVKNNSWEGFVEFF-------RVSDPETTVRNTLMAFAGFAGIGATI
D2ITA0_MCL1-04         REWLVKNNSWEGFVEFF-------RVSDPETTVRNTLMAFAGFAGIGATI
D2IT42_BCL2L10-02      RDWLLENGGWEGFCKF----SRIAREVNQESSMKTALFAAAGVGIAGLT-
D2ITA2_BCL2L1-02       DHWIQSNGGWKHFAAVFGSDAAAGARRTRDSHRRWMLVGAALLTGVLLG-
                         *: .*..*: *  .             ::  .  *.. * .       

D2ITA0_MCL1-03         ALLIR---
D2ITA0_MCL1-04         ALLIR---
D2IT42_BCL2L10-02      FLLVR---
D2ITA2_BCL2L1-02       ALLAKKHV
                        ** .   

© 1998-2019