Dataset for protein Mcl-1 of organism Fundulus heteroclitus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2T2A9_MCL1-02      MSKAPTSTQLVNCLISQNGVGDGQPHYRPGLQLPEVEMSSSSEDLRWDCS
A0A3Q2T2A9_MCL1-01      MSKAPTSTQLVNCLISQNGVGDGQPHYRPGLQLPEVEMSSSSEDLRWDCS
                        **************************************************

A0A3Q2T2A9_MCL1-02      KRPKNLRVMARNGFAVKSIQENRDDGSLPSTPEMQADSEAAGCGSHAGQE
A0A3Q2T2A9_MCL1-01      KRPKNLRVMARNGFAVKSIQENRDDGSLPSTPEMQADSEAAGCGSHAGQE
                        **************************************************

A0A3Q2T2A9_MCL1-02      ALDSDTTELISGFLRDFTGLSGHRWYTKKSLSTMKRVVEDLLSKHRYAYT
A0A3Q2T2A9_MCL1-01      ALDSDTTELISGFLRDFTGLSGHRWYTKKSLSTMKRVVEDLLSKHRYAYT
                        **************************************************

A0A3Q2T2A9_MCL1-02      GMIRKLNLDQKSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHL
A0A3Q2T2A9_MCL1-01      GMIRKLNLDQKSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHL
                        **************************************************

A0A3Q2T2A9_MCL1-02      KESGRSHCVDLVSREISTYLLTNQRDWLAKNNSWDGFVEFFKVEDTESTV
A0A3Q2T2A9_MCL1-01      KESGRSHCVDLVSREISTYLLTNQRDWLAKNNSWDGFVEFFKVEDTESTV
                        **************************************************

A0A3Q2T2A9_MCL1-02      RNTLMAFVGVAGIGAGLAFLIR-------------------------
A0A3Q2T2A9_MCL1-01      RNTLMAFVGVAGIGAGLAFLIRNSIKISFIGQDCSWAFTSPPTFPGL
                        **********************                         

© 1998-2019