Dataset for protein BCL-2-like of organism Fundulus heteroclitus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2T2A9_MCL1-02      MSKAPTSTQLVNCLISQNGVGDGQPHYRPGLQLPEVEMSSSSEDLRWDCS
A0A3Q2T2A9_MCL1-01      MSKAPTSTQLVNCLISQNGVGDGQPHYRPGLQLPEVEMSSSSEDLRWDCS
A0A3Q2PJS5_BCL2L10      --MCREPSHIAGRKMSCGLWKETVAVAEDYMRL-----------------
A0A3Q2NRP4_BCL2L1-      --MSYSNRELVEFYISYKLSQTNCP---NSLLRSEVAGDRTEGD------
A0A3Q2PN77_BCL2-01      -MANDCNRDIVENYIFHKLSKRGYAWRFDGVRDDDAAANGGLGD------
A0A3Q2QPL9_BCL2L1-      ---MSQNRELVLSYVKFKLSQRNYP--VNHIMLNEPPSDGGARD------
                                 :.   :         .     :                   

A0A3Q2T2A9_MCL1-02      KRPKNLRVMARNGFAVKSIQENRDDGSLPSTPEMQADSEAAGCGSHAGQE
A0A3Q2T2A9_MCL1-01      KRPKNLRVMARNGFAVKSIQENRDDGSLPSTPEMQADSEAAGCGSHAGQE
A0A3Q2PJS5_BCL2L10      ---------------------------------------------RCSSP
A0A3Q2NRP4_BCL2L1-      -------------------KDSP------ASSNGPLVSSWAGSPWQ---P
A0A3Q2PN77_BCL2-01      -------------------RSPTLVRRCRDAA--APGQDSDGDPRRVRGR
A0A3Q2QPL9_BCL2L1-      -------------------AESDEEQTAETHANGTVNGTSSGSPRRRQQQ
                                                                     .    

A0A3Q2T2A9_MCL1-02      ALDSDTTELISGFLRDFTGLSGHRWYTKKSLSTMKRVVEDLLSKHRYAYT
A0A3Q2T2A9_MCL1-01      ALDSDTTELISGFLRDFTGLSGHRWYTKKSLSTMKRVVEDLLSKHRYAYT
A0A3Q2PJS5_BCL2L10      HPAPPPPSEPAAAMRR--------------------LAQDVESQHQARFH
A0A3Q2NRP4_BCL2L1-      WAPHGRAEAVKSALRD--------------------SADEFEHLFTQSFS
A0A3Q2PN77_BCL2-01      LSQSDPHADIHRVLRE--------------------AGDELERLYQLDFA
A0A3Q2QPL9_BCL2L1-      PASTAAMEAVKVALRE--------------------TACEFELRYARAFN
                                     :*                        :.   .   : 

A0A3Q2T2A9_MCL1-02      GMIRK-LNLDQKSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQH
A0A3Q2T2A9_MCL1-01      GMIRK-LNLDQKSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQH
A0A3Q2PJS5_BCL2L10      ALAQSFLRHSQTDLCTSL-WKVMDEMVGDGHFNWGRVVSLFTFAGVLARQ
A0A3Q2NRP4_BCL2L1-      HLSLQ-LDITPDTAYHSF-KAVLDELFKDG-VNWGRVVGLFAFGGVLCVD
A0A3Q2PN77_BCL2-01      EMSQQ-LYITRDTARTRF-AEVVDELFRDG-VNWGRIIAFFEFGGTVCVE
A0A3Q2QPL9_BCL2L1-      DLHST-LHITPATAYQSF-ENVMNEVFRDG-VNWGRIVGLFAFGGALCVE
                         :    *          :   *  .:. **  ****: .:. *...:.  

A0A3Q2T2A9_MCL1-02      LKESG-RSH-----------CVDLVSREISTYLLTNQRDWLAKNNSWDGF
A0A3Q2T2A9_MCL1-01      LKESG-RSH-----------CVDLVSREISTYLLTNQRDWLAKNNSWDGF
A0A3Q2PJS5_BCL2L10      LQEQQGRSPGPDPGRQQEPVSCRELAETIADYLEKHKKDWLQENDGWDGF
A0A3Q2NRP4_BCL2L1-      CVQKN-MSE-----------LVPRIADWMTIYLDEQLDPWVRSQGGWECF
A0A3Q2PN77_BCL2-01      CASKEGMSS-----------QVDNIAEWMTEYLNGPLGSWIQDNGGWDAF
A0A3Q2QPL9_BCL2L1-      CVEKE-MSP-----------LVGRIVEWMTVYLDEQIDPWIQSQGGWERF
                          ..   *                :   :: **      *: .:..*: *

A0A3Q2T2A9_MCL1-02      VEFFKVEDTESTVRNTLMAFVGVAGIGAGLAFLIR---------------
A0A3Q2T2A9_MCL1-01      VEFFKVEDTESTVRNTLMAFVGVAGIGAGLAFLIRNSIKISFIGQDCSWA
A0A3Q2PJS5_BCL2L10      CNYAHGARGASQDSSMKTALVAVAGVGIAGLTFLLVR-------------
A0A3Q2NRP4_BCL2L1-      AKL-YGQDAAAAGRRFQETLNKWLLVGAALLTGFLLVVLFAKKR------
A0A3Q2PN77_BCL2-01      VEL-YDRQKESIFSCYWPSIKTVFGLAALGAASITIGAYLAQK-------
A0A3Q2QPL9_BCL2L1-      AEI-FGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFVQKRL-----
                         :        :       ::     :.      :                

A0A3Q2T2A9_MCL1-02      ----------
A0A3Q2T2A9_MCL1-01      FTSPPTFPGL
A0A3Q2PJS5_BCL2L10      ----------
A0A3Q2NRP4_BCL2L1-      ----------
A0A3Q2PN77_BCL2-01      ----------
A0A3Q2QPL9_BCL2L1-      ----------
                                  

© 1998-2019