Dataset for protein Bcl-xL of organism Fundulus heteroclitus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2NRP4_BCL2L1-      MSYSNRELVEFYISYKLSQTNCP-NSLLRSEVAGD------RTEGDKDSP
A0A3Q2QPL9_BCL2L1-      -MSQNRELVLSYVKFKLSQRNYPVNHIMLNEPPSDGGARDAESDEEQTAE
                           .*****  *:.:**** * * * :: .* ..*       :: :: : 

A0A3Q2NRP4_BCL2L1-      ASSNGPLVSSWAGSPW---QPWAPHGRAEAVKSALRDSADEFEHLFTQSF
A0A3Q2QPL9_BCL2L1-      THANGTVNGTSSGSPRRRQQQPASTAAMEAVKVALRETACEFELRYARAF
                        : :**.: .: :***.   *  *. .  **** ***::* ***  ::.:*

A0A3Q2NRP4_BCL2L1-      SHLSLQLDITPDTAYHSFKAVLDELFKDGVNWGRVVGLFAFGGVLCVDCV
A0A3Q2QPL9_BCL2L1-      NDLHSTLHITPATAYQSFENVMNEVFRDGVNWGRIVGLFAFGGALCVECV
                        . *   * *** ***:**: *::*:*.*******:********.***:**

A0A3Q2NRP4_BCL2L1-      QKNMSELVPRIADWMTIYLDEQLDPWVRSQGGWECFAKLYGQDAAAAGRR
A0A3Q2QPL9_BCL2L1-      EKEMSPLVGRIVEWMTVYLDEQIDPWIQSQGGWERFAEIFGGNAAAESRR
                        :*:** ** **.:***:*****:***:.****** **:::* :*** .**

A0A3Q2NRP4_BCL2L1-      FQETLNKWLLVGAALLTGFLLVVLFAKKR-
A0A3Q2QPL9_BCL2L1-      SQESFKNWLLLGMSVVTAFIAGSIFVQKRL
                         **::::***:* :::*.*:   :*.:** 

© 1998-2019