Dataset for protein BCL-2-like of organism Ficedula albicollis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3KKY6_MCL1-01        --------------------------------------------------
U3JTB2_BCL2A1-01      --METAEFYYVYYLAQDYLQYVLQE-------------------------
U3JSL7_BCL2L1-01      ------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEM
U3KEW4_BCL2-01        MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAA
                                                                        

U3KKY6_MCL1-01        --------------------------------------------------
U3JTB2_BCL2A1-01      ---------------------------------SHLGPAQTRVAHVLRTM
U3JSL7_BCL2L1-01      DGVLNGSPSWHA---PTSHIVNGASVHQSSLEVHEIRRAAD-VRQALREA
U3KEW4_BCL2-01        VAAAAGTSSDHTGPVSPHPEPPGSAAASPAPPAEGLRPAPQVVHLVLRQA
                                                                        

U3KKY6_MCL1-01        -----KKNKKNLPGMLRKLEIQQEEDLQS-VVEVAAHVFSDGVTNWGRVV
U3JTB2_BCL2A1-01      ASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFADGNTNWGRIM
U3JSL7_BCL2L1-01      GDEFELRYRRAFSDLTSQLHITPSTAYQS-FEQVVNELFRDG-VNWGRIV
U3KEW4_BCL2-01        GDEFSRRYQRDFAQMSGQLHLTPFTARSR-FVAVVEELFRDG-VNWGRIV
                            .    :  :  .: :      .  .  *    * ** .****::

U3KKY6_MCL1-01        TLIAFGAFVAKHLKSIKQEQSI---TSLAGIITDALVSSKRQWLESQGGW
U3JTB2_BCL2A1-01      TIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKSEWIDANGGW
U3JSL7_BCL2L1-01      AFFSFGGALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDPWIQENGGW
U3KEW4_BCL2-01        AFFEFGGVMCVESVNREMSPLV---DSIAAWMTEYLNRHLHNWIQDNGGW
                      ::: **. :                  :   :*  :      *:: :***

U3KKY6_MCL1-01        --------------------------------------------------
U3JTB2_BCL2A1-01      ENGFLTKFER--------------------RSLLSFSKITALFIAVVSLF
U3JSL7_BCL2L1-01      ER-FVDLYGNDAAAEVRKGQETFN------KWLLTGATVAGVLLLGSLLS
U3KEW4_BCL2-01        DA-FVELYGNSM-------RPLFDFSWISLKTILSLVLVGACITLGAYLG
                                                                        

U3KKY6_MCL1-01        ----
U3JTB2_BCL2A1-01      REYY
U3JSL7_BCL2L1-01      RK--
U3KEW4_BCL2-01        HK--
                          

© 1998-2019