Dataset for protein Mcl-1 of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M3XAP4_MCL1-03      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLV------------------------
M3XAP4_MCL1-02      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGS
M3XAP4_MCL1-01      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGS
Q7YRZ9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGS
                    ************************************                        

M3XAP4_MCL1-03      ------------------------------------------------------------
M3XAP4_MCL1-02      AGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIM
M3XAP4_MCL1-01      AGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIM
Q7YRZ9_MCL1-01      AGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEEMEGPAADAIM
                                                                                

M3XAP4_MCL1-03      ------------------------------------------------------------
M3XAP4_MCL1-02      SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDELFRQSLE
M3XAP4_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDELFRQSLE
Q7YRZ9_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDELFRQSLE
                                                                                

M3XAP4_MCL1-03      ---------ATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
M3XAP4_MCL1-02      IISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGWVCGV-----
M3XAP4_MCL1-01      IISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
Q7YRZ9_MCL1-01      IISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
                             ***************************************** :  :     

M3XAP4_MCL1-03      NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
M3XAP4_MCL1-02      ------------LPCRGPRRW---------------------HQKCAAGFCRCCWS----
M3XAP4_MCL1-01      NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
Q7YRZ9_MCL1-01      NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                                : . *  .*                     ::.*   :. .  .    

M3XAP4_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
M3XAP4_MCL1-02      --RSWF---------------------------------GISNKIAF---
M3XAP4_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Q7YRZ9_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                      *.*:                                 *:.  :*:   

© 1998-2019