Dataset for protein BCL-2-like of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337STN9_BCL2A1-      --MADGEFGYVLTLARDYTEH-----------------------------
A0A337STN9_BCL2A1-      --MADGEFGYVLTLARDYTEH-----------------------------
A0A2I2UAE3_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCG-------------------
A0A337RYG8_BCL2L10      --MADALRERTAQLLTDYLEY--------CA-------------------
M3XAP4_MCL1-03          --MFGLKRNAVIGLNL----Y--------CGGAGLAAGSGGASSSGGRLV
M3XAP4_MCL1-02          ------MFGLKRNAVIGLNLY--------CGGAGLAAGSGGASSSGGRLV
M3XAP4_MCL1-01          ------MFGLKRNAVIGLNLY--------CGGAGLAAGSGGASSSGGRLV
Q7YRZ9_MCL1-01          ------MFGLKRNAVIGLNLY--------CGGAGLAAGSGGASSSGGRLV
M3X1R9_BCL2-01          MAHAGRTGYDNREIVMKYIHY--------------------------KLS
M3XA94_BCL2L1-01        ------MSQSNRELVVDFLSY--------------------------KLS
Q8SQ42_BCL2L1-01        ------MSQSNRELVVDFLSY--------------------------KLS
                                            :                             

A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
M3XAP4_MCL1-03          ATG-----------------------------------------------
M3XAP4_MCL1-02          AVGKEATARREVGGGEAGAVIGGSAGASPPATLA-----PDARRVARPSP
M3XAP4_MCL1-01          AVGKEATARREVGGGEAGAVIGGSAGASPPATLA-----PDARRVARPSP
Q7YRZ9_MCL1-01          AVGKEATARREVGGGEAGAVIGGSAGASPPATLA-----PDARRVARPSP
M3X1R9_BCL2-01          QRGYEWD-----AGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPV
M3XA94_BCL2L1-01        QKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGN---PSWHLADSPAV
Q8SQ42_BCL2L1-01        QKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGN---PSWHLADSPAV
                                                                          

A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
M3XAP4_MCL1-02          IGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEP
M3XAP4_MCL1-01          IGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEP
Q7YRZ9_MCL1-01          IGAEGPDVTATPPKLLFFAATRCASPPEEMEGPAADAIMSPEEELDGYEP
M3X1R9_BCL2-01          APAAAAAAAAAGPALSPVPPVVHL--------------------------
M3XA94_BCL2L1-01        NGATGHSSSLDAREVIPMAAVKQ---------------------------
Q8SQ42_BCL2L1-01        NGATGHSSSLDAREVIPMAAVKQ---------------------------
                                                                          

A0A337STN9_BCL2A1-      --------------------------------------------------
A0A337STN9_BCL2A1-      --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
M3XAP4_MCL1-03          --------------------------------------------------
M3XAP4_MCL1-02          EPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDELFRQSLEI
M3XAP4_MCL1-01          EPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDELFRQSLEI
Q7YRZ9_MCL1-01          EPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDELFRQSLEI
M3X1R9_BCL2-01          --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
                                                                          

A0A337STN9_BCL2A1-      --------------VLQGPQPGSHPSRVSQVLQDVAFSVQGEVE---KKL
A0A337STN9_BCL2A1-      --------------VLQGPQPGSHPSRVSQVLQDVAFSVQGEVE---KKL
A0A2I2UAE3_BCL2L2-      ----------------AGPGEGPAADPLHQAMRAAGDEFETRFR---RTF
A0A337RYG8_BCL2L10      --------------REPGSPARTPSTPEAAVLRYLAAQIRQRHQRFLSAY
M3XAP4_MCL1-03          -----------AKDAKPLGGSGAASRKALETLRRVGDGVQRNHE---TAF
M3XAP4_MCL1-02          ISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHE---TAF
M3XAP4_MCL1-01          ISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHE---TAF
Q7YRZ9_MCL1-01          ISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHE---TAF
M3X1R9_BCL2-01          ------------------------------TLRQAGDDFSRRYR---RDF
M3XA94_BCL2L1-01        ------------------------------ALREAGDEFELRYR---RAF
Q8SQ42_BCL2L1-01        ------------------------------ALREAGDEFELRYR---RAF
                                                      .:.  .  .           

A0A337STN9_BCL2A1-      KPCLDKFHVVSVDTARTIFHQVMEKEFEDGII-NWGRIVTIFAFEGILIK
A0A337STN9_BCL2A1-      KPCLDKFHVVSVDTARTIFHQVMEKEFEDGII-NWGRIVTIFAFEGILIK
A0A2I2UAE3_BCL2L2-      SDLAAQLHVTP-GSAQQRFTQVSDELFQGGP--NWGRLVAFFVFGAALCA
A0A337RYG8_BCL2L10      RGY-------R-GNRVELVARLEQDLLSNPQTLSWGHVVALLTFAGTLLE
M3XAP4_MCL1-03          QGMLRKLDIKN-ENDVKSLSRVMVHVFSDGVT-NWGRIVTLISFGAFVAK
M3XAP4_MCL1-02          QGWVCGV------------------LPCRGPR-RW---------------
M3XAP4_MCL1-01          QGMLRKLDIKN-ENDVKSLSRVMVHVFSDGVT-NWGRIVTLISFGAFVAK
Q7YRZ9_MCL1-01          QGMLRKLDIKN-ENDVKSLSRVMVHVFSDGVT-NWGRIVTLISFGAFVAK
M3X1R9_BCL2-01          AEMSSQLHLTP-FTARGRFATVVEELFRDGV--NWGRIVAFFEFGGVMCV
M3XA94_BCL2L1-01        SDLTSQLHITP-GTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGALCV
Q8SQ42_BCL2L1-01        SDLTSQLHITP-GTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGALCV
                                                          *               

A0A337STN9_BCL2A1-      KLLQER---------------IVPDADAFKVSYFVAEFITKHTGEWIRQN
A0A337STN9_BCL2A1-      KLLQER---------------IVPDADAFKVSYFVAEFITKHTGEWIRQN
A0A2I2UAE3_BCL2L2-      ESVN-----------------KEMEPLVGQVQEWMVAYLETRLADWIHSS
A0A337RYG8_BCL2L10      RPPPGTYLNLTPDQQQELEWETNVGQDCQHLVALLCNRLTGRHRAWLEAH
M3XAP4_MCL1-03          HLKS-----------------INQESCIEPLAESITDVLVRTKRDWLVKQ
M3XAP4_MCL1-02          -----------------------HQKCAAGFCRCCWS------RSWF---
M3XAP4_MCL1-01          HLKS-----------------INQESCIEPLAESITDVLVRTKRDWLVKQ
Q7YRZ9_MCL1-01          HLKS-----------------INQESCIEPLAESITDVLVRTKRDWLVKQ
M3X1R9_BCL2-01          ESVN-----------------REMSPLVDNIALWMTEYLNRHLHTWIQDN
M3XA94_BCL2L1-01        ESVD-----------------KEMQVLVSRIATWMATYLNDHLEPWIQEN
Q8SQ42_BCL2L1-01        ESVD-----------------KEMQVLVSRIAAWMATYLNDHLEPWIQEN
                                                      .              *:   

A0A337STN9_BCL2A1-      GGWHSVQV------------------------------------------
A0A337STN9_BCL2A1-      GGWENGFVRKFEP-------------------KSGWLTFLEVTGKICKVL
A0A2I2UAE3_BCL2L2-      GGWAEFTALYGDGALEEARRLREGNWASV---RTVLTGAVALGALVTVGA
A0A337RYG8_BCL2L10      DGWDGFCLFFS-PMLP----------SSW---RRLLVQALLSCFTVMILI
M3XAP4_MCL1-03          RGWDGFVEFFHVEDLE----------GGI---RNVLLAFAGVAGVGAGLA
M3XAP4_MCL1-02          -------------------------------------------GISNKIA
M3XAP4_MCL1-01          RGWDGFVEFFHVEDLEGGI-------------RNVLLAFAGVAGVGAGLA
Q7YRZ9_MCL1-01          RGWDGFVEFFHVEDLEGGI-------------RNVLLAFAGVAGVGAGLA
M3X1R9_BCL2-01          GGWDAFVELYGPSM-------QPLFDFSWLSLKALLSLALVGACITLGAY
M3XA94_BCL2L1-01        GGWDTFVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSL
Q8SQ42_BCL2L1-01        GGWDTFVELYGNNAAAESRKGQERSN------RWFLTGMTVAGVVLLGSL
                                                                          

A0A337STN9_BCL2A1-      -------
A0A337STN9_BCL2A1-      SLLKNYY
A0A2I2UAE3_BCL2L2-      FFASK--
A0A337RYG8_BCL2L10      YFWRRLL
M3XAP4_MCL1-03          YLIR---
M3XAP4_MCL1-02          F------
M3XAP4_MCL1-01          YLIR---
Q7YRZ9_MCL1-01          YLIR---
M3X1R9_BCL2-01          LGHK---
M3XA94_BCL2L1-01        FSRK---
Q8SQ42_BCL2L1-01        FSRK---
                               

© 1998-2019