Dataset for protein Bfl1 of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337STN9_BCL2A1-      MADGEFGYVLTLARDYTEHVLQGPQPGSHPSRVSQVLQDVAFSVQGEVEK
A0A337STN9_BCL2A1-      MADGEFGYVLTLARDYTEHVLQGPQPGSHPSRVSQVLQDVAFSVQGEVEK
                        **************************************************

A0A337STN9_BCL2A1-      KLKPCLDKFHVVSVDTARTIFHQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A337STN9_BCL2A1-      KLKPCLDKFHVVSVDTARTIFHQVMEKEFEDGIINWGRIVTIFAFEGILI
                        **************************************************

A0A337STN9_BCL2A1-      KKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWHSVQV------
A0A337STN9_BCL2A1-      KKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPK
                        *************************************** .  *      

A0A337STN9_BCL2A1-      ------------------------
A0A337STN9_BCL2A1-      SGWLTFLEVTGKICKVLSLLKNYY
                                                

© 1998-2019