Dataset for protein Bcl-2 of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M3X1R9_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA
M3X1R9_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA
Q8I008_BCL2-01      MAHAGRTGYDNREIVMKYIHYELPQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA
                    *********************:*.************************************

M3X1R9_BCL2-02      RTSPPPPPVAPAAAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT
M3X1R9_BCL2-01      RTSPPPPPVAPAAAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT
Q8I008_BCL2-01      RTSPPPPPVAP--AAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT
                    ***********  ***********************************************

M3X1R9_BCL2-02      PFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLN
M3X1R9_BCL2-01      PFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLN
Q8I008_BCL2-01      PFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVEGVNREMSPLVDNIALWMTEYLN
                    **************************************.*********************

M3X1R9_BCL2-02      RHLHTWIQDNGGWLILL--------PRTSYELKSSRALREDVRISPSFLFKD-----
M3X1R9_BCL2-01      RHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q8I008_BCL2-01      RHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                    *************  ::        *  .:.  * .** . . :...: :       

© 1998-2019