Dataset for protein Mcl-1 of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8Y1W8_MCL1-01      MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKM
A0A3P8Y1W8_MCL1-02      MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKM
                        **************************************************

A0A3P8Y1W8_MCL1-01      DVDLGNGTADTPVRPTKLEVNMTKPNVLDSRLSDLADDSDDSLPCTPLMV
A0A3P8Y1W8_MCL1-02      DVDLGNGTADTPVRPTKLEVNMTKPNVLDSRLSDLADDSDDSLPCTPLMV
                        **************************************************

A0A3P8Y1W8_MCL1-01      TECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNKSLVTMK
A0A3P8Y1W8_MCL1-02      TECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNKSLVTMK
                        **************************************************

A0A3P8Y1W8_MCL1-01      RVVGDVIAKHTYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGR
A0A3P8Y1W8_MCL1-02      RVVGDVIAKHTYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGR
                        **************************************************

A0A3P8Y1W8_MCL1-01      IASLVGFGAVVSQHLKEMGKGNCVELVGQEISTYLLTDQRAWLVKNNAWD
A0A3P8Y1W8_MCL1-02      IASLVGFGAVVSQHLKEMGKGNCVELVGQEISTYLLTDQRAWLVKNNAWD
                        **************************************************

A0A3P8Y1W8_MCL1-01      GFVEFFHVEDPESSVRNTLMAFAGVAGIGATLALLIR
A0A3P8Y1W8_MCL1-02      GFVEFFHVEDPESS------------PIGLFLQVF--
                        **************             **  * ::  

© 1998-2019