Dataset for protein BCL-2-like of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8Y1W8_MCL1-01      MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKM
A0A3P8Y1W8_MCL1-02      MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKM
A0A3P8YNB4_BCL2-01      -------------------MADD---DNRFIVEKYICHKLLKRGYAWDFE
A0A3P9AAB2_BCL2-01      -------------------MANENPYDSRVIVENYIYDKLLKNGFVWEFQ
A0A3P8XYL5_BCL2L1-      -----------------------MTYNNKELVAYYITYKLSQRNYPINHT
A0A3P8XFS0_BCL2L1-      -----------------------MSYSNRELVVFFINYKLSQRNYSCCEL
A0A3P8XFS0_BCL2L1-      -----------------------MSYSNRELVVFFINYKLSQRNYSCCEL
                                                  ..  :        *          

A0A3P8Y1W8_MCL1-01      DVDLGNGTADTPVRPTKLEVNMTKPNVLDSRLSDLADDSDDSLPCTPLMV
A0A3P8Y1W8_MCL1-02      DVDLGNGTADTPVRPTKLEVNMTKPNVLDSRLSDLADDSDDSLPCTPLMV
A0A3P8YNB4_BCL2-01      DAEEEDGANNGS------MISPP--PGLVRRIHGASKAGQGSVPHISKWL
A0A3P9AAB2_BCL2-01      -TENQSRNNVFE------DPSPPNSPELFARRLQPPAAGEDNDPQFANRI
A0A3P8XYL5_BCL2L1-      GLTGAFDRTEGG------EVEEV--AAVTMHPNGTMNGTSPGTPTQQSPP
A0A3P8XFS0_BCL2L1-      ELEGASGRTEGE------EATAN--GSVGNGRNSRRNLGKPSTPQG----
A0A3P8XFS0_BCL2L1-      ELEGASGRTEGE------EATAN--GSVGNGRNSRRNLGKPSTPQG----
                                                   :           . . *      

A0A3P8Y1W8_MCL1-01      TECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNKSLVTMK
A0A3P8Y1W8_MCL1-02      TECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNKSLVTMK
A0A3P8YNB4_BCL2-01      SQPD---PH-------------AAIHRVLREAGDELERLYQPDFLEMSHQ
A0A3P9AAB2_BCL2-01      PQPD---PH-------------ARLHRVLRDAGNEIERMYQRDFAEMSGQ
A0A3P8XYL5_BCL2L1-      SSPRRTVGL-------------DAVKEALRDSANEFELRYALAFSDLSSQ
A0A3P8XFS0_BCL2L1-      -------CM-------------EAVKAALRDSADEFELRYTRAFSDLSSQ
A0A3P8XFS0_BCL2L1-      -------CM-------------EAVKAALRDSADEFELRYTRAFSDLSSQ
                                                :   **:  .  :  :      :: :

A0A3P8Y1W8_MCL1-01      RVVGDVIAKHTYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGR
A0A3P8Y1W8_MCL1-02      RVVGDVIAKHTYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGR
A0A3P8YNB4_BCL2-01      LYLTSSVAERRF---------------------REVIDELFRDG-VNWGR
A0A3P9AAB2_BCL2-01      LHITPSTAHGRF---------------------TAVIDELFSDG-VNWGR
A0A3P8XYL5_BCL2L1-      LHLTPATAYQSF---------------------ASVMDEVFRDG-VNWGR
A0A3P8XFS0_BCL2L1-      LHITPATAYHSF---------------------ESVMDEVFRDG-VNWGR
A0A3P8XFS0_BCL2L1-      LHITPATAYHSF---------------------ESVMDEVFRDG-VNWGR
                          :    *   :                       * ..:* ** .****

A0A3P8Y1W8_MCL1-01      IASLVGFGAVVSQHLKEMGKGNCVELVGQEISTYLLTDQRAWLVKNNAWD
A0A3P8Y1W8_MCL1-02      IASLVGFGAVVSQHLKEMGKGNCVELVGQEISTYLLTDQRAWLVKNNAWD
A0A3P8YNB4_BCL2-01      IIAFFEFGGTICVECVNKEMTSQVDHIAGWMTEYLNGPLHSWIQENGGWE
A0A3P9AAB2_BCL2-01      IVAFLEFGGTMCVESVNREMTPQVNNIVHWMTEYLNGPLQNWIQENGGWD
A0A3P8XYL5_BCL2L1-      VVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLDNHIQPWIESQGGWD
A0A3P8XFS0_BCL2L1-      VVGLFAFGGALCVECVEKDMSLLVARIADWMTTYLDEHIQPWIQIQGGWD
A0A3P8XFS0_BCL2L1-      VVGLFAFGGALCVECVEKDMSLLVARIADWMTTYLDEHIQPWIQIQGGWD
                        : .:. **..:.    :      *  :   :: **    . *:  :..*:

A0A3P8Y1W8_MCL1-01      GFVEFFHVEDPE-----SSVRNTLMAFAGVAGIGATLALLIR------
A0A3P8Y1W8_MCL1-02      GFVEFFHVEDPE-----SS------------PIGLFLQVF--------
A0A3P8YNB4_BCL2-01      AFVELYDRQRDS-VFCSWPSIKTVFGLAALGAASLTIGAYLTQK----
A0A3P9AAB2_BCL2-01      AFVEIYGQKRGS-LFHSWPFLKTMFSLAALGAAGVTIGAMFTQK----
A0A3P8XYL5_BCL2L1-      RFAEIFGKDAAANSRKSQESFKKWLLAGMTLVTGVVVGSLIAQKRL--
A0A3P8XFS0_BCL2L1-      RFADIFGRDAAADIRRSQESLRKWLLFG-------------MENAQWT
A0A3P8XFS0_BCL2L1-      RFADIFGRDAAADIRRSQESLRKWLLFGVMLLSGVLVGTLLMKKRQ--
                         *.:::  .                                       

© 1998-2019