Dataset for protein Bcl-xL of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8XYL5_BCL2L1-      MTYNNKELVAYYITYKLSQRNYPINHTGLTGAFDRTEGGEVEEVAAVTMH
A0A3P8XFS0_BCL2L1-      MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGNG
A0A3P8XFS0_BCL2L1-      MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGNG
                        *:*.*.***.::*.********.     * ** .**** *.   .:*   

A0A3P8XYL5_BCL2L1-      PNGTMNGTSPGTPTQQSPPSSPRRTVGLDAVKEALRDSANEFELRYALAF
A0A3P8XFS0_BCL2L1-      RNSRRNLGKPSTPQG-----------CMEAVKAALRDSADEFELRYTRAF
A0A3P8XFS0_BCL2L1-      RNSRRNLGKPSTPQG-----------CMEAVKAALRDSADEFELRYTRAF
                         *.  *  .*.**              ::*** ******:******: **

A0A3P8XYL5_BCL2L1-      SDLSSQLHLTPATAYQSFASVMDEVFRDGVNWGRVVGLFAFGGALCVECV
A0A3P8XFS0_BCL2L1-      SDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECV
A0A3P8XFS0_BCL2L1-      SDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECV
                        ********:******:** *******************************

A0A3P8XYL5_BCL2L1-      EKEMSPLVGRIADWMTVYLDNHIQPWIESQGGWDRFAEIFGKDAAANSRK
A0A3P8XFS0_BCL2L1-      EKDMSLLVARIADWMTTYLDEHIQPWIQIQGGWDRFADIFGRDAAADIRR
A0A3P8XFS0_BCL2L1-      EKDMSLLVARIADWMTTYLDEHIQPWIQIQGGWDRFADIFGRDAAADIRR
                        **:** **.*******.***:******: ********:***.****: *.

A0A3P8XYL5_BCL2L1-      SQESFKKWLLAGMTLVTGVVVGSLIAQKRL--
A0A3P8XFS0_BCL2L1-      SQESLRKWLLFG-------------MENAQWT
A0A3P8XFS0_BCL2L1-      SQESLRKWLLFGVMLLSGVLVGTLLMKKRQ--
                        ****:.**** *              ::    

© 1998-2019