Dataset for protein Bcl-2 of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8YNB4_BCL2-01      MADD---DNRFIVEKYICHKLLKRGYAWDFEDAEEEDGANNGSMISPP--
A0A3P9AAB2_BCL2-01      MANENPYDSRVIVENYIYDKLLKNGFVWEFQ-TENQSRNNVFEDPSPPNS
                        **::   *.*.***:**  ****.*:.*:*: :*::.  *  .  ***  

A0A3P8YNB4_BCL2-01      PGLVRRIHGASKAGQGSVPHISKWLSQPDPHAAIHRVLREAGDELERLYQ
A0A3P9AAB2_BCL2-01      PELFARRLQPPAAGEDNDPQFANRIPQPDPHARLHRVLRDAGNEIERMYQ
                        * *. *   .. **:.. *::::.:.****** :*****:**:*:**:**

A0A3P8YNB4_BCL2-01      PDFLEMSHQLYLTSSVAERRFREVIDELFRDGVNWGRIIAFFEFGGTICV
A0A3P9AAB2_BCL2-01      RDFAEMSGQLHITPSTAHGRFTAVIDELFSDGVNWGRIVAFLEFGGTMCV
                         ** *** **::*.*.*  **  ****** ********:**:*****:**

A0A3P8YNB4_BCL2-01      ECVNKEMTSQVDHIAGWMTEYLNGPLHSWIQENGGWEAFVELYDRQRDSV
A0A3P9AAB2_BCL2-01      ESVNREMTPQVNNIVHWMTEYLNGPLQNWIQENGGWDAFVEIYGQKRGSL
                        *.**.***.**::*. **********:.********:****:*..:*.*:

A0A3P8YNB4_BCL2-01      FCSWPSIKTVFGLAALGAASLTIGAYLTQK
A0A3P9AAB2_BCL2-01      FHSWPFLKTMFSLAALGAAGVTIGAMFTQK
                        * *** :**:*.*******.:**** :***

© 1998-2019