Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7AVA6_MCL1-01          MFGLKRNAVIGLNLYCGGAGLGAGGGGASSPGGRLLAAGKEATARREGGG
F7CP56_BCL2A1-01        -----------------------MTDCEFGYIHMLAQDYLKYVLQ-----
F6ZPD4_BCL2L10-01       -----------------------VAEALRERTALLLIDYLQRRARE----
F6PH48_BCL2L2-01        ----------------------MATPASAPDTRALVADFVGYKLRQKGY-
F6WQI0_BCL2L1-01        ---------------------------MSQSNRELVVDFLSYKLSQKGYN
F6WQI0_BCL2L1-02        ---------------------------MSQSNRELVVDFLSYKLSQKGYN
A0A3Q2HRY3_BCL2-02      ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYE
A0A3Q2HRY3_BCL2-01      ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYE
                                                          :               

F7AVA6_MCL1-01          GEAGAVIGGSAGGSPQTTLAPDSLRVARPSPIGAEGPDVTAPSSRLLFFA
F7CP56_BCL2A1-01        --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
F6WQI0_BCL2L1-01        WSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLAD-----------S
F6WQI0_BCL2L1-02        WSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLAD-----------S
A0A3Q2HRY3_BCL2-02      WD-----AGDAGAAPLGATPVPGIFSSQPGRTPAPART-----------S
A0A3Q2HRY3_BCL2-01      WD-----AGDAGAAPLGATPVPGIFSSQPGRTPAPART-----------S
                                                                          

F7AVA6_MCL1-01          PTRCASPPEGMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLEFVREA
F7CP56_BCL2A1-01        ------IPQPGSGPSKTS--------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
F6PH48_BCL2L2-01        --------VCGAGPGEGPA-------------------------------
F6WQI0_BCL2L1-01        PTGNGATGHSSSLDAREVI-------------------------------
F6WQI0_BCL2L1-02        PTGNGATGHSSSLDAREVI-------------------------------
A0A3Q2HRY3_BCL2-02      PLLPPAAPAGAAGPALSPV-------------------------------
A0A3Q2HRY3_BCL2-01      PLLPPAAPAGAAGPALSPV-------------------------------
                                                                          

F7AVA6_MCL1-01          SSGPCTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDTKPMG
F7CP56_BCL2A1-01        --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
F6PH48_BCL2L2-01        --------------------------------------------------
F6WQI0_BCL2L1-01        --------------------------------------------------
F6WQI0_BCL2L1-02        --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
                                                                          

F7AVA6_MCL1-01          GSGAASRKALETLRRVGDGVQRNHETAFQGM----LRKLDIKNEDDVKSL
F7CP56_BCL2A1-01        ------RVLQDIAFSVQNEVEKNLKPCLDNF-------HVVSIDAARTIF
F6ZPD4_BCL2L10-01       ----PATPEVAVLRCVAAQIQPRNQRVLSRYRGFRGDHVGLAARMAQAIF
F6PH48_BCL2L2-01        ----A-DPLHQAMRAAGDEFETRFRRTFSDL----AAQLHVTPGSAQQRF
F6WQI0_BCL2L1-01        ----PMAAVKQALREAGDEFELRYRRAFSDL----TSQLHITPGTAYQSF
F6WQI0_BCL2L1-02        ----PMAAVKQALREAGDEFELRYRRAFSDL----TSQLHITPGTAYQSF
A0A3Q2HRY3_BCL2-02      ----P-PVVHLTLRQAGDDFSRRYRRDFAEM----SSQLHLTPFTARGRF
A0A3Q2HRY3_BCL2-01      ----P-PVVHLTLRQAGDDFSRRYRRDFAEM----SSQLHLTPFTARGRF
                                       .   .. .    :            :        :

F7AVA6_MCL1-01          SRVMAHVFSDGVTNWGRIVTLISFGAFVAKH----LKSINQESCIEPLAE
F7CP56_BCL2A1-01        NQVMEKQFEDGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTY-KEISY
F6ZPD4_BCL2L10-01       GD------RHV-PSWGRVAALVTLAGTLLERAPRGTYRKPKRGYKLELRE
F6PH48_BCL2L2-01        TQVSDELFQGG-PNWGRLVAFFVFGAALCAE----SVNKEMEPLVGQVQE
F6WQI0_BCL2L1-01        EQVVNELFRDG-VNWGRIVAFFSFGGALCVE----SVDKEMQVLVSRIAT
F6WQI0_BCL2L1-02        EQVVNELFRDG-VNWGRIVAFFSFGGALCVE----SVDKEMQVLVSRIAT
A0A3Q2HRY3_BCL2-02      ATVVEELFRDG-VNWGRIVAFFEFGGVMCVE----SVNREMSPLVDNIAL
A0A3Q2HRY3_BCL2-01      ATVVEELFRDG-VNWGRIVAFFEFGGVMCVE----SVNREMSPLVDNIAL
                                     .***: ::. : . :                   :  

F7AVA6_MCL1-01          SITDVLVRTKRDWLVKQR---------GWD--------------------
F7CP56_BCL2A1-01        FVAEFITKNTGEWIRQNG---------GWE--------------------
F6ZPD4_BCL2L10-01       WKAGVDRDWLRAWWTSCAHGSRGGTAPGWR--------------------
F6PH48_BCL2L2-01        WMVAYLETRLADWIHSSG---------GWA------------EFTALYGD
F6WQI0_BCL2L1-01        WMATYLNDHLEPWIQENG---------GWD------------TFVELYGN
F6WQI0_BCL2L1-02        WMATYLNDHLEPWIQENG---------GWKETALGTFCYFVSSLMRLSGQ
A0A3Q2HRY3_BCL2-02      WMTEYLNRHLHTWIQDNG---------GWQ------------LCQAPTGS
A0A3Q2HRY3_BCL2-01      WMTEYLNRHLHTWIQDNG---------GWD------------AFVELYGP
                          .         *  .           **                     

F7AVA6_MCL1-01          --------------GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
F7CP56_BCL2A1-01        -------------NGFVKKFEPKSGWLTFLEVTGKMC--------EILFL
F6ZPD4_BCL2L10-01       -------------LTMDGFCDFSLTLPASQRILLVRFLLSCFSASVLIYL
F6PH48_BCL2L2-01        -------------GALEEARRLREGNWASVRTVLTGAVALG----ALVTV
F6WQI0_BCL2L1-01        -------------NAAAESRKGQERFNRWFLTGMTVA--------GVVLL
F6WQI0_BCL2L1-02        -------------GGALQLAPSYSAFWADSRAPLGTR--------GFSLA
A0A3Q2HRY3_BCL2-02      QEMFSGGWTIHSGSPLQNLCVSRAGNWFSEKKNMTWCLTSDKDVIDRTPI
A0A3Q2HRY3_BCL2-01      -----------SMRPLFDF------SWLSLKALLSLALVG-----ACITL
                                                                          

F7AVA6_MCL1-01          R-------------------------------------
F7CP56_BCL2A1-01        KQYY----------------------------------
F6ZPD4_BCL2L10-01       WTKLS---------------------------------
F6PH48_BCL2L2-01        GAFFASK-------------------------------
F6WQI0_BCL2L1-01        GSLFSRK-------------------------------
F6WQI0_BCL2L1-02        LQEMPLQ-------------------------------
A0A3Q2HRY3_BCL2-02      RMYQGRKSREAEIQSQCRPPCMLLHLLEIQVPVLFLSE
A0A3Q2HRY3_BCL2-01      GAYLGHK-------------------------------
                                                              

© 1998-2019