Dataset for protein Bcl-xL of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6WQI0_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSA
F6WQI0_BCL2L1-02      MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSA
                      **************************************************

F6WQI0_BCL2L1-01      INGNPSWHLADSPTGNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
F6WQI0_BCL2L1-02      INGNPSWHLADSPTGNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

F6WQI0_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
F6WQI0_BCL2L1-02      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      **************************************************

F6WQI0_BCL2L1-01      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWD-----------
F6WQI0_BCL2L1-02      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWKETALGTFCYFV
                      **************************************.           

F6WQI0_BCL2L1-01      -TFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
F6WQI0_BCL2L1-02      SSLMRLSGQGGALQLAPSYSAFWADSRAPLGTRGFSLALQEMPLQ
                       ::: * *:..* :   . . *.    : : . *. *  . :. :

© 1998-2019