Dataset for protein Bfl1 of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7CP56_BCL2A1-03      MTDC----------------------------------------------
F7CP56_BCL2A1-04      MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEK
F7CP56_BCL2A1-02      --------------------------------------------------
F7CP56_BCL2A1-01      MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEK
                                                                        

F7CP56_BCL2A1-03      -----------------------------------------------ILI
F7CP56_BCL2A1-04      NLKPCLDNFHVVSIDAARTIFNQVMEKQFEDGIINWGRIMTIFAFEGILI
F7CP56_BCL2A1-02      ------------------------MEKQFEDGIINWGRIMTIFAFEGILI
F7CP56_BCL2A1-01      NLKPCLDNFHVVSIDAARTIFNQVMEKQFEDGIINWGRIMTIFAFEGILI
                                                                     ***

F7CP56_BCL2A1-03      KKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVIAHSQYQKS
F7CP56_BCL2A1-04      KKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGW----------
F7CP56_BCL2A1-02      KKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVIAHSQYQKS
F7CP56_BCL2A1-01      KKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVIAHSQYQKS
                      ****************************************          

F7CP56_BCL2A1-03      KRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLASPE
F7CP56_BCL2A1-04      --------------------------ENGFVKKFEPKSGWLTFLEVTGKM
F7CP56_BCL2A1-02      KRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLASPE
F7CP56_BCL2A1-01      KRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLASPE
                                                :. *: .:: :*..: :::::.  

F7CP56_BCL2A1-03      EILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGLGFDKHGNRLGRG
F7CP56_BCL2A1-04      CEILFLKQYY----------------------------------------
F7CP56_BCL2A1-02      EILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGLGFDKHGNRLGRG
F7CP56_BCL2A1-01      EILSLPKTSWNIHQPGEEEVREEALSTAAWR-------------------
                        : : *  :                                        

F7CP56_BCL2A1-03      KGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVLYED
F7CP56_BCL2A1-04      --------------------------------------------------
F7CP56_BCL2A1-02      KGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVLYED
F7CP56_BCL2A1-01      --------------------------------------------------
                                                                        

F7CP56_BCL2A1-03      SSAS
F7CP56_BCL2A1-04      ----
F7CP56_BCL2A1-02      SSAS
F7CP56_BCL2A1-01      ----
                          

© 1998-2019