Dataset for protein Bcl-2 of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2HRY3_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPLGATPVPGIFS
A0A3Q2HRY3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPLGATPVPGIFS
                        **************************************************

A0A3Q2HRY3_BCL2-02      SQPGRTPAPARTSPLLPPAAPAGAAGPALSPVPPVVHLTLRQAGDDFSRR
A0A3Q2HRY3_BCL2-01      SQPGRTPAPARTSPLLPPAAPAGAAGPALSPVPPVVHLTLRQAGDDFSRR
                        **************************************************

A0A3Q2HRY3_BCL2-02      YRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVM
A0A3Q2HRY3_BCL2-01      YRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVM
                        **************************************************

A0A3Q2HRY3_BCL2-02      CVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWQLCQAPTGSQEM
A0A3Q2HRY3_BCL2-01      CVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP---
                        **************************************:      *.   

A0A3Q2HRY3_BCL2-02      FSGGWTIHSGSPLQNLCVSRAGNWFSEKKNMTWCLTSDKDVIDRTPIRMY
A0A3Q2HRY3_BCL2-01      --------SMRPLFDF------SWLSLKALLSLALVG-----ACITLGAY
                                *  ** ::      .*:* *  :: .*..        .:  *

A0A3Q2HRY3_BCL2-02      QGRKSREAEIQSQCRPPCMLLHLLEIQVPVLFLSE
A0A3Q2HRY3_BCL2-01      LGHK-------------------------------
                         *.*                               

© 1998-2019