Dataset for protein BCL-2-like of organism Dicentrarchus labrax

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1X9JZA1_BCL2-01      MANECNRNIVEKYICHKLSKQGYEWGF---DAVRNADAGNNGSIVAPPPS
E6ZFR0_BCL2L1-01        -MSYSNRELVEFFISYKLSQRNHPTSLLRPENAGERTEGDKANSAARNGL
                          . .**::** :*.:***:..:  .:   : . :   *::.. .*    

A0A1X9JZA1_BCL2-01      LVRRCRGASTGPDSESIPHLCTRLPQSDPHAAIHRVLREAGDELERLYQP
E6ZFR0_BCL2L1-01        LASKNTSGQPGTSSSSGADI----------EAVKAALRDSADEFELLFTQ
                        *. .  ....*..*.* . :           *:: .**::.**:* *:  

A0A1X9JZA1_BCL2-01      DFTEMSRQLYLTSTTAQRRFADVIDELFRDGVNWGRIIAFFEFGGTVCVE
E6ZFR0_BCL2L1-01        AFSDLSSQIDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVE
                         *:::* *: :*. ** . * .*:**:*.********:.:* ***.:***

A0A1X9JZA1_BCL2-01      CVAKEEMAAQVNNIAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSV
E6ZFR0_BCL2L1-01        CVEK-DMSELVSRIADWMTMYLDEHISPWIQSQGGWDCFAEVFGRDAAAE
                        ** * :*:  *..**:*** **:  :..***.:****.*.*::.*:  : 

A0A1X9JZA1_BCL2-01      FSCSWPSIKTVFGVAALGAASLTIGAYLTQK-
E6ZFR0_BCL2L1-01        ARRSRETLSRWLLIGVALLMGAVVGVLIAKKH
                           *. ::.  : :..    . .:*. :::* 

© 1998-2019