Dataset for protein Mcl-1 of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F8W4Q8_MCL1-02      ------------------------------------------------------------
Q8UWD6_MCL1-01      ---MFAGRNNDNGFWPCTGLQSKPLV---------------------------IPELKAH
F8W4Q8_MCL1-01      ---MFAGRNNDNGFWPCTGLQSKPLV---------------------------IPELKAH
Q568W5_MCL1-01      ---MFAGRNNDNGFWPCTGLQSKPLV---------------------------IPELKAH
Q568V1_MCL1-01      ------------MSFLAQGVQTPTLKTCVEDELDGYIEEEEAPLKRLRPGTNGLKGLQLD
Q1L8X3_MCL1-01      MALSLDFRRTATMSFFAQGVQTPTLKTCVEDELDGYIEEEEAPLKRLRPGTNGLKGLQLD
Q9I9N3_MCL1-01      MALSLDFRRTATMSFFAQGVQTPTLKTCVEDELDGYTEEEEAPLKRLRPGTNGLKGLQLD
                                                                                

F8W4Q8_MCL1-02      ------------------------------------------------------------
Q8UWD6_MCL1-01      NQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLKIFTGLPHSKSGRKQVLSTM
F8W4Q8_MCL1-01      NQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLKIFTGLPHSKSGRKQVLSTM
Q568W5_MCL1-01      NQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLIIFTGLPHSKSGRKQVLSTM
Q568V1_MCL1-01      GRF-VSTTDGSLPTTPDPEELDY--AELERDTRQLLLDFYRTHTGMCPVDRKLHHAIPTM
Q1L8X3_MCL1-01      GRF-VSATDGSLPTTPDPEELDY--AELERDTRQLLLDFYRTHTGMCPVDRKLHHAIPTM
Q9I9N3_MCL1-01      GRF-VSATDGSLPTTPDPEELDY--AELERDTRQLLLDFYRTHTGMCPVDRKLHHAIPTM
                                                                                

F8W4Q8_MCL1-02      ---------MILWTLSGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
Q8UWD6_MCL1-01      RRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
F8W4Q8_MCL1-01      RRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
Q568W5_MCL1-01      RRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
Q568V1_MCL1-01      KRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGA
Q1L8X3_MCL1-01      KRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGA
Q9I9N3_MCL1-01      KRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGA
                                 : .*** **:*:.:  .:.**. :*: :*.**.*********::***

F8W4Q8_MCL1-02      MLCKYQNDRGHSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTL
Q8UWD6_MCL1-01      MLCKYQNDRGHSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTL
F8W4Q8_MCL1-01      MLCKYQNDRGHSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTL
Q568W5_MCL1-01      MLCKYQNDRGHSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTL
Q568V1_MCL1-01      VVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSCHGFVEFFHQEDVESVVRHGL
Q1L8X3_MCL1-01      VVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSWHGFVEFFHQEDVESVVRHGL
Q9I9N3_MCL1-01      VVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSWHGFVEFFHQEDVESVVRHGL
                    ::*.  ::  :.: *  *.*:***** :**.****.**:  *******  *.*:.**: *

F8W4Q8_MCL1-02      LTIGGVATLSAALAYWIR
Q8UWD6_MCL1-01      LTIGSVATLSAALAYWIR
F8W4Q8_MCL1-01      LTIGGVATLSAALAYWIR
Q568W5_MCL1-01      LTIGGVATLSAALAYWIR
Q568V1_MCL1-01      LALVGCAGIGAGLAFLIR
Q1L8X3_MCL1-01      LALVGCAGIGAGLAFLIR
Q9I9N3_MCL1-01      LALVGCAGIGAGLAFLIR
                    *:: . * :.*.**: **

© 1998-2019