Dataset for protein BCL-2-like of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F8W4Q8_MCL1-02        --------------------------------------------------
Q568V1_MCL1-01        ------------MSFLAQGVQTPTLKTCVEDELDGY---------IEEEE
Q1L8X3_MCL1-01        MALSLDFRRTATMSFFAQGVQTPTLKTCVEDELDGY---------IEEEE
Q9I9N3_MCL1-01        MALSLDFRRTATMSFFAQGVQTPTLKTCVEDELDGY---------TEEEE
Q90Z98_BCL2L1-02      ------------MSYYNRELVVFFIKYKLSQ--RNY--PCNHIGLTEDTN
Q90Z98_BCL2L1-01      ------------MSYYNRELVVFFIKYKLSQ--RNY--PCNHIGLTEDTN
Q564A4_BCL2-01        --------MANEISYDNRNIVEKYLKHKLSK--RGYVWKCQSS----AEE
Q8UWD6_MCL1-01        -------------MFAGRN----------ND--NGF-WPCTGL----QSK
F8W4Q8_MCL1-01        -------------MFAGRN----------ND--NGF-WPCTGL----QSK
Q568W5_MCL1-01        -------------MFAGRN----------ND--NGF-WPCTGL----QSK
                                                                        

F8W4Q8_MCL1-02        --------------------------------------------------
Q568V1_MCL1-01        APLKRLRPGTNGLKGLQLDGRFVSTTDGSLPTTPDPEELDYAELERDTRQ
Q1L8X3_MCL1-01        APLKRLRPGTNGLKGLQLDGRFVSATDGSLPTTPDPEELDYAELERDTRQ
Q9I9N3_MCL1-01        APLKRLRPGTNGLKGLQLDGRFVSATDGSLPTTPDPEELDYAELERDTRQ
Q90Z98_BCL2L1-02      RTDGAEENGEGAAGATTLVNGTMNRTNASSTGTPPQSPAS-----SPQRQ
Q90Z98_BCL2L1-01      RTDGAEENGEGAAGATTLVNGTMNRTNASSTGTPPQSPAS-----SPQRQ
Q564A4_BCL2-01        D--------------DTFNKAVEESSPNSDRRLQAPSAGG-----GNNSE
Q8UWD6_MCL1-01        PLVIPELKAHNQFAVDSLQGSV-PSSPSDETGDYPPTALD-----MDTRE
F8W4Q8_MCL1-01        PLVIPELKAHNQFAVDSLQGSV-PSSPSDETGDYPPTALD-----MDTRE
Q568W5_MCL1-01        PLVIPELKAHNQFAVDSLQGSV-PSSPSDETGDYPPTALD-----MDTRE
                                                                        

F8W4Q8_MCL1-02        -----------------------------------MILWTLSGMIARLNL
Q568V1_MCL1-01        LLLDFYRTHTGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQL
Q1L8X3_MCL1-01        LLLDFYRTHTGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQL
Q9I9N3_MCL1-01        LLLDFYRTHTGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQL
Q90Z98_BCL2L1-02      T------------NGSGGLDAVKEALRDSANEFELRYSRAFNDLSSQLHI
Q90Z98_BCL2L1-01      T------------NGSGGLDAVKEALRDSANEFELRYSRAFNDLSSQLHI
Q564A4_BCL2-01        CL--IARVTRSDPHLR-----LYRVLRDAGDEIERIYQREFEEMSQQMVF
Q8UWD6_MCL1-01        IIDTFLKIFTGLPHSKSGRKQVLSTMRRVVDNLAVKHELAYKGMIARLNL
F8W4Q8_MCL1-01        IIDTFLKIFTGLPHSKSGRKQVLSTMRRVVDNLAVKHELAYKGMIARLNL
Q568W5_MCL1-01        IIDTFLIIFTGLPHSKSGRKQVLSTMRRVVDNLAVKHELAYKGMIARLNL
                                                               . :  .: :

F8W4Q8_MCL1-02        EQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKY
Q568V1_MCL1-01        DSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQDQC
Q1L8X3_MCL1-01        DSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQDQC
Q9I9N3_MCL1-01        DSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGAVVCSRLKELQQDQC
Q90Z98_BCL2L1-02      TPATAYQSFE-SVMDEVFRDG-VNWGRIVGLFAFGGALCVECVEKEMSPL
Q90Z98_BCL2L1-01      TPATAYQSFE-SVMDEVFRDG-VNWGRIVGLFAFGGALCVECVEKEMSPL
Q564A4_BCL2-01        NPNSAQRSFL-TVAEELFRDG-VNWGRIIAFFEFGGTMCVESVNREMASQ
Q8UWD6_MCL1-01        EQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKY
F8W4Q8_MCL1-01        EQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKY
Q568W5_MCL1-01        EQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKY
                             .*   :   :* ** .***** .:. **. :*    :      

F8W4Q8_MCL1-02        VRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRN------
Q568V1_MCL1-01        VERVAEQISSYLTSEQQDWILKNKSCHGFVEFFHQEDVESVVRH------
Q1L8X3_MCL1-01        VERVAEQISSYLTSEQQDWILKNKSWHGFVEFFHQEDVESVVRH------
Q9I9N3_MCL1-01        VERVAEQISSYLTSEQQDWILKNKSWHGFVEFFHQEDVESVVRH------
Q90Z98_BCL2L1-02      VGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGKDAAAESRKSQESFKK
Q90Z98_BCL2L1-01      VGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGKDAAAESRKSQESFKK
Q564A4_BCL2-01        VDNIAHWMTDYLNGPLENWIEENGGWDAFVEMYGQQRDSVFHPF------
Q8UWD6_MCL1-01        VRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRN------
F8W4Q8_MCL1-01        VRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRN------
Q568W5_MCL1-01        VRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRN------
                      *  :.  :: **      **  : .   *.*::                 

F8W4Q8_MCL1-02        ------TLLT------IGGVATLSAALAYWIR
Q568V1_MCL1-01        ------GLLA------LVGCAGIGAGLAFLIR
Q1L8X3_MCL1-01        ------GLLA------LVGCAGIGAGLAFLIR
Q9I9N3_MCL1-01        ------GLLA------LVGCAGIGAGLAFLIR
Q90Z98_BCL2L1-02      WLFAGMTLLT---GVVVGGLIAQKRL------
Q90Z98_BCL2L1-01      WLFAGMTLLT---GVVVGGLIAQKRL------
Q564A4_BCL2-01        ------SYLTKVLGLAALGLAGVTIGAFFAQK
Q8UWD6_MCL1-01        ------TLLT------IGSVATLSAALAYWIR
F8W4Q8_MCL1-01        ------TLLT------IGGVATLSAALAYWIR
Q568W5_MCL1-01        ------TLLT------IGGVATLSAALAYWIR
                              *:        .             

© 1998-2019