Dataset for protein BCL-2-like of organism Cyprinodon variegatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2EDX8_MCL1-01      MSYLILPQNGVVDGQTHYSPEIAAPEIPMNSPMGSLHRNLMK--RPKDLQ
A0A3Q2GL87_BCL2L10      --------------MCREPLHITGRKMSCGLWKETVAVA-----------
A0A3Q2C6K4_BCL2L1-      --------------MSYSNRELVEFYISYKLSQTNCPNSLLR-------S
A0A3Q2FR43_BCL2L1-      ---------------MSQNRELVLFYIKFKLSQRNYPVNHIMLNEPPNGT
                                             :.   :       .               

A0A3Q2EDX8_MCL1-01      VATNGYVGKNLSDNSADDGGSLPCTPEMPTDSHPATPGGHAGDEALDNDT
A0A3Q2GL87_BCL2L10      ---------EDYMRLRCSSPL--PAPPPPSEPAA----------AMRRLA
A0A3Q2C6K4_BCL2L1-      EVTGGRTEGDKDASASSNGPLFNSRPSPPGKPRAPHGSIEAVKSALKDSA
A0A3Q2FR43_BCL2L1-      GAQGAEQDDERTPETHANGTFNGTSPGSPRRQQASTAAMEAVKAALRDTA
                                 :       ..      *  *    .          *:   :

A0A3Q2EDX8_MCL1-01      KELISSFLRDFTGLPKQ--RRNQTKALSTMKRVVEDVLSKHRYAYNGMMN
A0A3Q2GL87_BCL2L10      QDMETQHQARFHTLAQSFLRHSGTDLCSSLRKVMDE--------------
A0A3Q2C6K4_BCL2L1-      NEFELLFSQSFSDLSMQ-LDITPDTAYHSFKAVLDE--------------
A0A3Q2FR43_BCL2L1-      CEFELRYARAFNDLHST-LHITPATAYQSFENVMNE--------------
                         ::   .   *  *       .      ::  *:::              

A0A3Q2EDX8_MCL1-01      KLCLDEVPDNMGFVSSVATSLFSDGTTNWGRIVSLVAFGAVVCQHLKEK-
A0A3Q2GL87_BCL2L10      --------------------MVGDGLFNWGRVVSLFTFAGVLARQLQEQT
A0A3Q2C6K4_BCL2L1-      --------------------LFKDGI-NWGRVVGLFAFGGVLCVHCVQK-
A0A3Q2FR43_BCL2L1-      --------------------VFRDGV-NWGRIVGLFAFGGALCVECVEK-
                                            :. **  ****:*.*.:*...:.    :: 

A0A3Q2EDX8_MCL1-01      --------------GRENCVEL-VSQEISTYLLQNQRDWLVKNNSWNGFV
A0A3Q2GL87_BCL2L10      GKNPGLDPGRQQELQTEPVSCRALAETIADYLETHKKDWLQENNGWDGFC
A0A3Q2C6K4_BCL2L1-      --------------NMSELVSR-IADWMTIYLDEQLNPWIHSQGGWDCFA
A0A3Q2FR43_BCL2L1-      --------------EMSPLVGR-IVEWMTVYLDEQIDPWIQSQGGWERFA
                                        .      : : :: **  :   *: .:..*: * 

A0A3Q2EDX8_MCL1-01      EFF----RVEDPEATMRNTLMAFVGVAGIGATLAFLIR-----
A0A3Q2GL87_BCL2L10      N-YARNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR------
A0A3Q2C6K4_BCL2L1-      KLYGQDAAAEGRRSHETLNKWLLVGAALLGGVLLTVLVAKKR-
A0A3Q2FR43_BCL2L1-      EIFGGDAAAESRRSQESLKNWLLLGMSVATALIAGSIFAHKRL
                        : :       .  :        . * .     :          

© 1998-2019