Dataset for protein Bcl-xL of organism Cyprinodon variegatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2C6K4_BCL2L1-      MSYSNRELVEFYISYKLSQTNCPNSLLR-------SEVTGGRTEGDKDAS
A0A3Q2FR43_BCL2L1-      -MSQNRELVLFYIKFKLSQRNYPVNHIMLNEPPNGTGAQGAEQDDERTPE
                           .***** ***.:**** * * . :        : . *.  :.:. ..

A0A3Q2C6K4_BCL2L1-      ASSNGPLFNSRPSPPGKPRAPHGSIEAVKSALKDSANEFELLFSQSFSDL
A0A3Q2FR43_BCL2L1-      THANGTFNGTSPGSPRRQQASTAAMEAVKAALRDTACEFELRYARAFNDL
                        : :**.: .: *..* . .*. .::****:**.*:* **** ::.:*.**

A0A3Q2C6K4_BCL2L1-      SMQLDITPDTAYHSFKAVLDELFKDGINWGRVVGLFAFGGVLCVHCVQKN
A0A3Q2FR43_BCL2L1-      HSTLHITPATAYQSFENVMNEVFRDGVNWGRIVGLFAFGGALCVECVEKE
                           * *** ***:**: *::*:*.**:****:********.*** **:*:

A0A3Q2C6K4_BCL2L1-      MSELVSRIADWMTIYLDEQLNPWIHSQGGWDCFAKLYGQDAAAEGRRSHE
A0A3Q2FR43_BCL2L1-      MSPLVGRIVEWMTVYLDEQIDPWIQSQGGWERFAEIFGGDAAAESRRSQE
                        ** **.**.:***:*****::***:*****: **:::* *****.***:*

A0A3Q2C6K4_BCL2L1-      TLNKWLLVGAALLGGVLLTVLVAKKR-
A0A3Q2FR43_BCL2L1-      SLKNWLLLGMSVATALIAGSIFAHKRL
                        :*::***:* ::  .::   :.*:** 

© 1998-2019