Dataset for protein Mcl-1 of organism Cynoglossus semilaevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8V8T6_MCL1-01      LDMVLISSVCLTLCT-----------------------------------
A0A3P8VKS9_MCL1-02      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8VKS9_MCL1-01      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8VKS9_MCL1-05      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8VKS9_MCL1-04      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8VKS9_MCL1-03      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
                        ::::  ... *.:.*                                   

A0A3P8V8T6_MCL1-01      --------------------------------------------------
A0A3P8VKS9_MCL1-02      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8VKS9_MCL1-01      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8VKS9_MCL1-05      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8VKS9_MCL1-04      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8VKS9_MCL1-03      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
                                                                          

A0A3P8V8T6_MCL1-01      -----------LENDTRQLICDFLKDFTTKSTQRLVESKALSTMKRVVKG
A0A3P8VKS9_MCL1-02      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8VKS9_MCL1-01      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8VKS9_MCL1-05      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8VKS9_MCL1-04      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8VKS9_MCL1-03      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
                                   *:.**.:** :* .****:*...  * ***:******..

A0A3P8V8T6_MCL1-01      ILDKHRHAFSGMINNLSFENGVYNIGVVGAVARSLFRDGTSNWGRIVSLV
A0A3P8VKS9_MCL1-02      VLEKHRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLV
A0A3P8VKS9_MCL1-01      VLEKHRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLV
A0A3P8VKS9_MCL1-05      VLEKHRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLV
A0A3P8VKS9_MCL1-04      VLEKHRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLV
A0A3P8VKS9_MCL1-03      VLEKHRYAYNGMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLV
                        :*:***:*:.****:**:**   :: .:.:**.*** ***:*****.***

A0A3P8V8T6_MCL1-01      AFGAVLCQHLKEKGWENTVDQVGQEIASYLLSYQKDWLLKNNSWDGFVEF
A0A3P8VKS9_MCL1-02      AFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLKNNSWDGFVEF
A0A3P8VKS9_MCL1-01      AFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLKNNSWDGFVEF
A0A3P8VKS9_MCL1-05      AFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLKNNSWDGFVEF
A0A3P8VKS9_MCL1-04      AFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLKNNSWDGFVEF
A0A3P8VKS9_MCL1-03      AFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLKNNSWDGFVEF
                        *****:****** *.**:.: **.**:*******.***************

A0A3P8V8T6_MCL1-01      FQGQEPEKAIRCTLLGFVGFAGLWATLALLMRYFLRFVW-----------
A0A3P8VKS9_MCL1-02      FRVEDPEATMRNTLLGLFGVAGLGATLALLIRDFNSIGKAFTVAFDAMFL
A0A3P8VKS9_MCL1-01      FRVEDPEATMRNTLLGLFGVAGLGATLALLIRSRK---------------
A0A3P8VKS9_MCL1-05      FRVEDPEATMRNTLLGLFGVAGLGATLALLIRWK----------------
A0A3P8VKS9_MCL1-04      FRVEDPEATMRNTLLGLFGVAGLGATLALLIR------------------
A0A3P8VKS9_MCL1-03      FRVEDPEATMRNTLLGLFGVAGLGATLALLIR------------------
                        *. ::** ::* ****:.*.*** ******:*                  

A0A3P8V8T6_MCL1-01      ----
A0A3P8VKS9_MCL1-02      FIRR
A0A3P8VKS9_MCL1-01      ----
A0A3P8VKS9_MCL1-05      ----
A0A3P8VKS9_MCL1-04      ----
A0A3P8VKS9_MCL1-03      ----
                            

© 1998-2019