Dataset for protein BCL-2-like of organism Cynoglossus semilaevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8VKS9_MCL1-02      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8VKS9_MCL1-01      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8VKS9_MCL1-05      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8VKS9_MCL1-04      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8VKS9_MCL1-03      MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLS
A0A3P8V8T6_MCL1-01      ----------------------------LDMVLISSVCLTLCTLENDTRQ
A0A3P8UWG7_BCL2L1-      -----------------------------------------TLTFNINRK
A0A3P8WUE9_BCL2-01      ---------------------------------MYLVPNSAGMASECNRY
A0A3P8VMA1_BCL2L1-      -------------------------------------------MSCSNRE
A0A3P8W7K5_BCL2L10      ------------------------------------MCNSASPSAVSTSS
                                                                       .  

A0A3P8VKS9_MCL1-02      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8VKS9_MCL1-01      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8VKS9_MCL1-05      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8VKS9_MCL1-04      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8VKS9_MCL1-03      THNDSMSSVTETQRRPKDLQVNTANGHARKSHCEVDEGSEPCTPEPHSEA
A0A3P8V8T6_MCL1-01      LICDFLKDFTTKST------------------------------------
A0A3P8UWG7_BCL2L1-      LVVDYIQYKLSQRNFPVHHLGLGDSPNRTDGEEAGLGAEQRTSTHANGTV
A0A3P8WUE9_BCL2-01      IVEKYICHKLAKRGYVWEH------DEDRDGDAANNGSIVSRPPTLVHRC
A0A3P8VMA1_BCL2L1-      LVKFFLGYKLSQRNYPESLLMLRIGGEQREGEEVTTASSNGVPQTPSAVL
A0A3P8W7K5_BCL2L10      EQSDIAGRKMSCGLWKETLAV--------AEDYLSLCCSSPRPAPPPP--
                                                                          

A0A3P8VKS9_MCL1-02      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8VKS9_MCL1-01      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8VKS9_MCL1-05      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8VKS9_MCL1-04      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8VKS9_MCL1-03      ELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDD
A0A3P8V8T6_MCL1-01      ----------------QRLV----------------ESKALSTMKRVVKG
A0A3P8UWG7_BCL2L1-      NGTSSGTPPAS-PLRQQHSA----------------SDTSLDSIKEALRD
A0A3P8WUE9_BCL2-01      RGASTGPGNDGIPNLCKRPP----------------APEAHAAIHRVLRE
A0A3P8VMA1_BCL2L1-      QHCSGA-----------------------------------EAVKAALKD
A0A3P8W7K5_BCL2L10      --SESA-----------------------------------AAMRHLAQD
                                                                  ::.     

A0A3P8VKS9_MCL1-02      VLEKHRYAYNGMINKLSLENRQGD---LTFISSVAKSLFGDGTTNWGRIT
A0A3P8VKS9_MCL1-01      VLEKHRYAYNGMINKLSLENRQGD---LTFISSVAKSLFGDGTTNWGRIT
A0A3P8VKS9_MCL1-05      VLEKHRYAYNGMINKLSLENRQGD---LTFISSVAKSLFGDGTTNWGRIT
A0A3P8VKS9_MCL1-04      VLEKHRYAYNGMINKLSLENRQGD---LTFISSVAKSLFGDGTTNWGRIT
A0A3P8VKS9_MCL1-03      VLEKHRYAYNGMINKLSLENRQGD---LTFISSVAKSLFGDGTTNWGRIT
A0A3P8V8T6_MCL1-01      ILDKHRHAFSGMINNLSFENGVYN---IGVVGAVARSLFRDGTSNWGRIV
A0A3P8UWG7_BCL2L1-      SANEFELRYARAFSDLHQQLHITPATAYQSFENVMDEVFRDG-VNWGRII
A0A3P8WUE9_BCL2-01      AGDELERLYQPDFSEMSRQLYLTSSTAQRRFTEVIDELFRDG-VNWGRII
A0A3P8VMA1_BCL2L1-      SADEFELRFTQAFRNLFLKLDLTPDTVYHSFKSVMDEVFRDG-VNWGRIV
A0A3P8W7K5_BCL2L10      MEKQHQARFQTLSQSFLRQCGSEP---CVCLRKVMEELVGDGHLNWGRVV
                          .:    :     .:  :           .  *  .:. **  ****: 

A0A3P8VKS9_MCL1-02      SLVAFGAVVCQHLKECG--------------------QENSTELVGREIS
A0A3P8VKS9_MCL1-01      SLVAFGAVVCQHLKECG--------------------QENSTELVGREIS
A0A3P8VKS9_MCL1-05      SLVAFGAVVCQHLKECG--------------------QENSTELVGREIS
A0A3P8VKS9_MCL1-04      SLVAFGAVVCQHLKECG--------------------QENSTELVGREIS
A0A3P8VKS9_MCL1-03      SLVAFGAVVCQHLKECG--------------------QENSTELVGREIS
A0A3P8V8T6_MCL1-01      SLVAFGAVLCQHLKEKG--------------------WENTVDQVGQEIA
A0A3P8UWG7_BCL2L1-      GLFAFGGALSVECVEKE--------------------MSQLVARIADWMT
A0A3P8WUE9_BCL2-01      AFFEFGGVVCVECAAKED-------------------LTPQVEQVVDWMT
A0A3P8VMA1_BCL2L1-      GLFTFGGVLCVECVQRN--------------------MSELVPRIADWMT
A0A3P8W7K5_BCL2L10      SIFTFTGVLAKQLLVQKGLKPGQEPEAGQELGPEPGTCRELAETIAD---
                        .:. * ..:.                               .  :     

A0A3P8VKS9_MCL1-02      SYLLSYQRDWLLKNNSWDGFVEFFRVEDPEATMRN--TLLGLFGVAGLGA
A0A3P8VKS9_MCL1-01      SYLLSYQRDWLLKNNSWDGFVEFFRVEDPEATMRN--TLLGLFGVAGLGA
A0A3P8VKS9_MCL1-05      SYLLSYQRDWLLKNNSWDGFVEFFRVEDPEATMRN--TLLGLFGVAGLGA
A0A3P8VKS9_MCL1-04      SYLLSYQRDWLLKNNSWDGFVEFFRVEDPEATMRN--TLLGLFGVAGLGA
A0A3P8VKS9_MCL1-03      SYLLSYQRDWLLKNNSWDGFVEFFRVEDPEATMRN--TLLGLFGVAGLGA
A0A3P8V8T6_MCL1-01      SYLLSYQKDWLLKNNSWDGFVEFFQGQEPEKAIRC--TLLGFVGFAGLWA
A0A3P8UWG7_BCL2L1-      VYLDNHIQPWIETQGGWEHFAELFGQDAAAESRRSQESFKKWLLAGMTLV
A0A3P8WUE9_BCL2-01      EYLNGPLNIWIKENGGWDAFVELYDRQGESAFSCSWPSIKTVFGLAALGA
A0A3P8VMA1_BCL2L1-      MYLDEYIDPWIQSQGGWDRFAEIFGTDCIPRTRSCRDTVRRWLLVGAGLL
A0A3P8W7K5_BCL2L10      -YLGEEKKAWLLENGGWEGFCEFSHS---ARELSQDSSMKTALFAAASVG
                         **      *:  :..*: * *:              :.   .  .    

A0A3P8VKS9_MCL1-02      TLALLIRDFNSIGKAFTVAFDAMFLFIRR
A0A3P8VKS9_MCL1-01      TLALLIRSRK-------------------
A0A3P8VKS9_MCL1-05      TLALLIRWK--------------------
A0A3P8VKS9_MCL1-04      TLALLIR----------------------
A0A3P8VKS9_MCL1-03      TLALLIR----------------------
A0A3P8V8T6_MCL1-01      TLALLMRYFLRFVW---------------
A0A3P8UWG7_BCL2L1-      TGVVVGSLIAQKRL---------------
A0A3P8WUE9_BCL2-01      ASLTIGAYLTQK-----------------
A0A3P8VMA1_BCL2L1-      AAVLIGVLITKKH----------------
A0A3P8W7K5_BCL2L10      LAGLTFLLVR-------------------
                                                     

© 1998-2019