Dataset for protein Bcl-xL of organism Cynoglossus semilaevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8UWG7_BCL2L1-      TLTFNINRKLVVDYIQYKLSQRNFPVHHLGLGDSPNRTDGEEAGLGAEQR
A0A3P8VMA1_BCL2L1-      --MSCSNRELVKFFLGYKLSQRNYPESLLMLRIGGEQREGEEV-------
                              **:**  :: *******:*   * *  . :. :***.       

A0A3P8UWG7_BCL2L1-      TSTHANGTVNGTSSGTPPASPLRQQHSASDTSLDSIKEALRDSANEFELR
A0A3P8VMA1_BCL2L1-      --------TTASSNGVPQTPSAVLQHCSGA---EAVKAALKDSADEFELR
                                ...:*.*.* :..   **.:.    :::* **.***:*****

A0A3P8UWG7_BCL2L1-      YARAFSDLHQQLHITPATAYQSFENVMDEVFRDGVNWGRIIGLFAFGGAL
A0A3P8VMA1_BCL2L1-      FTQAFRNLFLKLDLTPDTVYHSFKSVMDEVFRDGVNWGRIVGLFTFGGVL
                        ::.** :*. :* :** *.*:**:.***************:***:***.*

A0A3P8UWG7_BCL2L1-      SVECVEKEMSQLVARIADWMTVYLDNHIQPWIETQGGWEHFAELFGQDAA
A0A3P8VMA1_BCL2L1-      CVECVQRNMSELVPRIADWMTMYLDEYIDPWIQSQGGWDRFAEIFGTDCI
                        .****:.:**:**.*******:***::*:***::****:.***:** *. 

A0A3P8UWG7_BCL2L1-      AESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3P8VMA1_BCL2L1-      PRTRSCRDTVRRWLLVGAGLLAAVLIGVLITKKH-
                        . :* ..::...***.*  *::.*::* **::*. 

© 1998-2019