Dataset for protein Mcl-1 of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5I9Q7_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL--------------
A0A2K5I9Q7_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2K5I9Q7_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
                        ************************************              

A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFA
A0A2K5I9Q7_MCL1-02      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFA
                                                                          

A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2K5I9Q7_MCL1-02      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
                                                                          

A0A2K5I9Q7_MCL1-03      --------------------------------------ATGAKDTQPMGR
A0A2K5I9Q7_MCL1-01      NSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTQPMGR
A0A2K5I9Q7_MCL1-02      NSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTQPMGR
                                                              ************

A0A2K5I9Q7_MCL1-03      SGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMI
A0A2K5I9Q7_MCL1-01      SGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMI
A0A2K5I9Q7_MCL1-02      SGATSRKALETLRRVGDGVQRNHETAFQGWVCGV----------------
                        ***************************** :  :                

A0A2K5I9Q7_MCL1-03      HVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRT
A0A2K5I9Q7_MCL1-01      HVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRT
A0A2K5I9Q7_MCL1-02      -LPCRGPRRW---------------------HQKCAAGFCRCCWS-----
                         : . *  .*                     ::.*   :. .  .     

A0A2K5I9Q7_MCL1-03      KRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K5I9Q7_MCL1-01      KRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K5I9Q7_MCL1-02      -RSWF---------------------------------GISNQIALL--
                         *.*:                                 *:.  :* *  

© 1998-2019