Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5K3B0_BCL2L10      MADQLRERTNVADPLRERTERLLADYLGCCAREPGTP-------------
A0A2K5HEK7_BCL2L2-      -----MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG-----------
A0A2K5HEK7_BCL2L2-      -----MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG-----------
A0A2K5I9Q7_MCL1-03      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL-
A0A2K5I9Q7_MCL1-01      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2K5I9Q7_MCL1-02      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2K5H963_BCL2L1-      ----------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEG
A0A2K5HK49_BCL2-01      ----MAHAGRTGYDNREIVMKYIHYKLSQRGYEW--------DAGDVGAA
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      ------MTDCEFGYIYRLAQDYLQYVLQIPQ-------------------
A0A2K5KAB6_BCL2A1-      ------MTDCEFGYIYRLAQDYLQYVLQIPQ-------------------
                                                                          

A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      TEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVP
A0A2K5I9Q7_MCL1-02      TEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVP
A0A2K5H963_BCL2L1-      TESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA-----
A0A2K5HK49_BCL2-01      TPGAAPAPGIFSSQPG-HTPHPAASRDPVARTSPLPTPAAPAAAAGPA--
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      DVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKR
A0A2K5I9Q7_MCL1-02      DVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKR
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5HEK7_BCL2L2-      --------------------------------------------------
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      PAVLPLLELVGESNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLRE
A0A2K5I9Q7_MCL1-02      PAVLPLLELVGESNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLRE
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5K3B0_BCL2L10      -------------EPRPSTPEAAVLRSAAARLRQLHRSFFSAYLG----Y
A0A2K5HEK7_BCL2L2-      -------------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVT
A0A2K5HEK7_BCL2L2-      -------------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVT
A0A2K5I9Q7_MCL1-03      -ATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIK
A0A2K5I9Q7_MCL1-01      QATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIK
A0A2K5I9Q7_MCL1-02      QATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV---
A0A2K5H963_BCL2L1-      --------------------VKQALREAGDEFELRYRRAFSDLTSQLHIT
A0A2K5HK49_BCL2-01      -------------LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT
A0A2K5H963_BCL2L1-      -----------------------MWKRTGLRPQKGLNRRWRPPVPSMATH
A0A2K5KAB6_BCL2A1-      -------------PGSGPSKTSRVLQKVAFSVQEEVEKNLKPCLDNVNVA
A0A2K5KAB6_BCL2A1-      -------------PGSGPSKTSRVLQKVAFSVQEEVEKNLKPCLDNVNVA
                                                 . ..                     

A0A2K5K3B0_BCL2L10      P-GNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWK
A0A2K5HEK7_BCL2L2-      P-GSAQQRFTQVSDELFQGGP--NWGRLVAFFVFGAALCA----------
A0A2K5HEK7_BCL2L2-      P-GSAQQRFTQVSDELFQGGP--NWGRLVAFFVFGAALCA----------
A0A2K5I9Q7_MCL1-03      N-EDDVKSLSRVMIHVFSDGV-TNWGRIVTLISFGAFVAK----------
A0A2K5I9Q7_MCL1-01      N-EDDVKSLSRVMIHVFSDGV-TNWGRIVTLISFGAFVAK----------
A0A2K5I9Q7_MCL1-02      ---------------LPCRGP-RRW-------------------------
A0A2K5H963_BCL2L1-      P-GTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGALCV----------
A0A2K5HK49_BCL2-01      P-FTARGRFATVVEELFRDGV--NWGRIVAFFEFGGVMCV----------
A0A2K5H963_BCL2L1-      P-GTAYQSFEQVVNELFRDG--VNWGRIVAFFSFGGALCV----------
A0A2K5KAB6_BCL2A1-      SIDTARTIFNQVMEKEFEDGI-INWGRIVTIFAFEGILIK----------
A0A2K5KAB6_BCL2A1-      SIDTARTIFNQVMEKEFEDGI-INWGRIVTIFAFEGILIK----------
                                           .    *                         

A0A2K5K3B0_BCL2L10      KRSFQPRLKEQEGDVA---RDCQRLVALLSSRLAGQHRAWLQAQGGWDGF
A0A2K5HEK7_BCL2L2-      ----ESVNKEMEPLVG---QVQEWMVAYLETRL----ADWIHSSGGWAEF
A0A2K5HEK7_BCL2L2-      ----ESVNKEMEPLVG---QVQEWMVAYLETRL----ADWIHSSGGWELE
A0A2K5I9Q7_MCL1-03      ----HLKTINQESCIE---PLAESITDVLVRTK----RDWLVKQRGWDGF
A0A2K5I9Q7_MCL1-01      ----HLKTINQESCIE---PLAESITDVLVRTK----RDWLVKQRGWDGF
A0A2K5I9Q7_MCL1-02      ----------HQKCAA---GFCRCCWS----------RSWF---------
A0A2K5H963_BCL2L1-      ----ESVDKEMQVLVS---RIATWMATYLNDHL----EPWIQENGGWDTF
A0A2K5HK49_BCL2-01      ----ESVNREMSPLVD---NIALWMTEYLNRHL----HTWIQDNGGWDAF
A0A2K5H963_BCL2L1-      ----ESVDKEMQVLVS---RIATWMATYLNDHL----EPWIQENGGWDTF
A0A2K5KAB6_BCL2A1-      ----KLLRQRIAPDVDTYKEISYFVAEFIMNNT----GEWIRQNGGWE--
A0A2K5KAB6_BCL2A1-      ----KLLRQRIAPDVDTYKEISYFVAEFIMNNT----GEWIRQNGGWG--
                                                               *:         

A0A2K5K3B0_BCL2L10      CHFFRTPFPL----------------------------------------
A0A2K5HEK7_BCL2L2-      TALYGDGALE----------------------------------------
A0A2K5HEK7_BCL2L2-      AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEAD
A0A2K5I9Q7_MCL1-03      VEFFHVEDLE----------------------------------------
A0A2K5I9Q7_MCL1-01      VEFFHVEDLE----------------------------------------
A0A2K5I9Q7_MCL1-02      --------------------------------------------------
A0A2K5H963_BCL2L1-      VELYGNNAAAESRKGQERFNRWFLTGMT----------------------
A0A2K5HK49_BCL2-01      VELYGPSM-------------WPLFDFS----------------------
A0A2K5H963_BCL2L1-      VELYGNNAAAESRKGQ----------------------------------
A0A2K5KAB6_BCL2A1-      ------NGFVKKFEPK----------------------------------
A0A2K5KAB6_BCL2A1-      ------K-------------------------------------------
                                                                          

A0A2K5K3B0_BCL2L10      -------------------------AFWRKLLIQAFLACLLTTAFGYLWT
A0A2K5HEK7_BCL2L2-      ---------------EARRLREGNWASVRTVLTGAVALGALVTVGAFFAS
A0A2K5HEK7_BCL2L2-      ARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEF
A0A2K5I9Q7_MCL1-03      -------------------------GGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K5I9Q7_MCL1-01      -------------------------GGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K5I9Q7_MCL1-02      ---------------------------------------GISNQIALL--
A0A2K5H963_BCL2L1-      -------------------------------------VAGVVLLGSLFSR
A0A2K5HK49_BCL2-01      -------------------------WLSLKTLLSLALVGACITLGAYLGH
A0A2K5H963_BCL2L1-      -------------------------ERFNRWFLTGMTVAGVVLLGSLFSR
A0A2K5KAB6_BCL2A1-      -------------------------SGWMTFLEVTGKICEMLSLLKQYC-
A0A2K5KAB6_BCL2A1-      ---------------------------WHNHMPM---LVESVAHKKKKMA
                                                                          

A0A2K5K3B0_BCL2L10      RLL-----------------------------------------------
A0A2K5HEK7_BCL2L2-      K-------------------------------------------------
A0A2K5HEK7_BCL2L2-      SDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART
A0A2K5I9Q7_MCL1-03      --------------------------------------------------
A0A2K5I9Q7_MCL1-01      --------------------------------------------------
A0A2K5I9Q7_MCL1-02      --------------------------------------------------
A0A2K5H963_BCL2L1-      K-------------------------------------------------
A0A2K5HK49_BCL2-01      K-------------------------------------------------
A0A2K5H963_BCL2L1-      K-------------------------------------------------
A0A2K5KAB6_BCL2A1-      --------------------------------------------------
A0A2K5KAB6_BCL2A1-      L-------------------------------------------------
                                                                          

A0A2K5K3B0_BCL2L10      ------------------------------------
A0A2K5HEK7_BCL2L2-      ------------------------------------
A0A2K5HEK7_BCL2L2-      TNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5I9Q7_MCL1-03      ------------------------------------
A0A2K5I9Q7_MCL1-01      ------------------------------------
A0A2K5I9Q7_MCL1-02      ------------------------------------
A0A2K5H963_BCL2L1-      ------------------------------------
A0A2K5HK49_BCL2-01      ------------------------------------
A0A2K5H963_BCL2L1-      ------------------------------------
A0A2K5KAB6_BCL2A1-      ------------------------------------
A0A2K5KAB6_BCL2A1-      ------------------------------------
                                                            

© 1998-2019